DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and ARI12

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001184919.1 Gene:ARI12 / 837098 AraportID:AT1G05880 Length:496 Species:Arabidopsis thaliana


Alignment Length:405 Identity:87/405 - (21%)
Similarity:137/405 - (33%) Gaps:140/405 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SATLEEEEPSLSDEASKPLNETLLDLQL--ESEER--LNITDEERVRAKAHF-------FVHCSQ 165
            ::.:..|..:.:||:.  :|..|.|.|.  :|.:|  ..:..||.:||....       |...|:
plant     4 NSVIGSEVDAEADESY--VNAALEDGQTGKKSVQRNYATVLTEEDIRALMEIDVQSVSDFTSLSK 66

  Fly   166 CDK---LCNGKLRVRCALCK---GGAFTVHRDPECWDDVLKSRRIPGHCESLEVACVDNAAGDPP 224
            .:.   |.:.:..|.| :||   .||.:|.      |.|          ..||:        |||
plant    67 AEATLLLSHLRWNVDC-ICKQWSAGAQSVR------DSV----------GLLEL--------DPP 106

  Fly   225 FAEFFFKCAEHVSGGEKDFAAPLNLIKNNIKNVPCLACTDVSDTVLVFPCASQHVTCIDCFRHYC 289
            ..:..:.|.   :.||          .:..||:..::|              .|..|..|:..:.
plant   107 SDDNEYFCG---ACGE----------SHPHKNLASVSC--------------GHRICTRCWTSHI 144

  Fly   290 RSRLGERQFMPHPDFGYTLPCP------AGCEHSF-IEEIHHFKLLTREEYDRYQRFATEEYV-- 345
            ...:.|:   |..::...|.||      |.|..|. ::.|..|  .::.|...|.::....||  
plant   145 NKIISEK---PAAEWNLWLKCPVRVGLHASCPASVGLDTIERF--ASKREKFNYNQYLLRSYVDN 204

  Fly   346 --------LQAGGVLCP---QPGCGMGLLVEPDCRKVTCQNGCGYVFCRNCLQGYHIGECLPEGT 399
                    :|  |..|.   .||.|...:   .|.::.       .||.||.:..|         
plant   205 RETMKWHPIQ--GSRCAIDLSPGSGNASV---SCHRLV-------RFCWNCREDAH--------- 248

  Fly   400 GASATNSCEYTVDPNRAAEARWDEASNVTIKVSTKPCPKC--RTPTERDGGCMHMVCTRAGCGFE 462
                     ..||...|  |:|       :..:..|||||  |.|..:|.. :.|.|  ..|.:.
plant   249 ---------SPVDCKTA--AKW-------LLENAVPCPKCKLRIPRNQDNS-LKMKC--LPCNYV 292

  Fly   463 WCWVCQTEWTRDCMG 477
            :||.|..:|..|..|
plant   293 FCWFCHVDWIEDMEG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 14/68 (21%)
IBR <435..471 CDD:279784 14/37 (38%)
ARI12NP_001184919.1 Zn_Tnp_IS91 <111..>139 CDD:291017 8/54 (15%)
IBR 193..253 CDD:214763 16/89 (18%)
IBR <266..301 CDD:303000 14/37 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11685
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.