DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT5G60250

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_200833.1 Gene:AT5G60250 / 836147 AraportID:AT5G60250 Length:655 Species:Arabidopsis thaliana


Alignment Length:289 Identity:62/289 - (21%)
Similarity:96/289 - (33%) Gaps:85/289 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 FKCAEHVSGGEKDFAAPLNLIKNNIKNV----------------PCLACTDVSDTVL-----VFP 273
            |...:||.....|......|.:.:|.::                .|..|  .:|.|.     |..
plant   256 FSSYQHVLVARNDVKFAYKLARESILSMVTPHEDPRQAKAVLKEECAIC--FNDIVAEGMFSVDK 318

  Fly   274 CASQHVTCIDCFRHYCRSRLGERQFMPHPDFGYTLPCP-AGCEHSFIEEIHHFKLLTREEYDRYQ 337
            |  :|..|..|.:.:...:|..         |....|| .||:...:.:... ||||.:....:|
plant   319 C--RHRFCFQCVKQHVEVKLLH---------GMAPKCPHDGCKSELVIDACG-KLLTPKLSKLWQ 371

  Fly   338 RFATEEYVLQAGGVLCPQPGCG---------------MGLLVEPDCRK-VTCQNGCGYVFCRNCL 386
            :...|..:.....|.||.|.|.               :.|..:...|: |.|:.    :||.:|.
plant   372 QRLQENAIPVTERVYCPYPRCSALMSKTKISESAKSLLSLYPKSGVRRCVECRG----LFCVDCK 432

  Fly   387 QGYHIGECLPEGTGASATNSC-EY-TVDPNRAAEARWDEASNVTIKVST-----KPCPKCRTPTE 444
            ..:|            ...|| || .:.|...|:       :|.:|...     :.|.||:...|
plant   433 VPWH------------GNLSCTEYKKLHPEPPAD-------DVKLKSLANNKMWRQCGKCQHMIE 478

  Fly   445 RDGGCMHMVCTRAGCGFEWCWVCQTEWTR 473
            ...||.|:.|.   ||.|:|:.|...|.:
plant   479 LSQGCNHITCR---CGHEFCYNCGGGWNK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 14/71 (20%)
IBR <435..471 CDD:279784 13/35 (37%)
AT5G60250NP_200833.1 RVT_3 155..279 CDD:372609 5/22 (23%)
RING_Ubox 300..350 CDD:388418 14/62 (23%)
IBR 368..441 CDD:214763 15/88 (17%)
IBR 459..502 CDD:366672 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.