DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT5G07640

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_196381.1 Gene:AT5G07640 / 830657 AraportID:AT5G07640 Length:316 Species:Arabidopsis thaliana


Alignment Length:318 Identity:63/318 - (19%)
Similarity:88/318 - (27%) Gaps:139/318 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 CKG--------------GAFTV----HRDPECWDDVLKSRRIPG-----HCESLEVACVDNA--- 219
            |||              |.|.|    |.|...::    ..::.|     |.::.|:|.:.:|   
plant    11 CKGLVSEEVIRDESKQIGGFGVAICDHEDNRLYE----MNKVLGGEESTHQQAAELAALIHALNW 71

  Fly   220 AGDPPFAEFFFKC-----AEHVSG-GEKDFAAPLNLIKN----NIKNVPCLACTDVSDTVLVFPC 274
            |.:.......|.|     .|:|:| .|.:.:....|:|.    ..|...|.|...:.|...|...
plant    72 ALELDLGRVTFFCDDSNILEYVTGKAEPNESTVATLVKEVSLLQSKFSFCEALPVMKDITFVLKL 136

  Fly   275 ASQHV--------------TCIDCFRHYCRSRLGERQFMPHPDFGYTLPCPAGCEHSFIEEIHHF 325
            |...:              ||..|:.|..            .|..:.:|   ||.|.|..:    
plant   137 AKDAIASQIRWREGDVYMETCPVCYEHVT------------SDEKFEVP---GCFHRFCFD---- 182

  Fly   326 KLLTREEYDRYQRFATEEYVLQAGGVLCPQPGCGMGLLVEPDCRKV------------------- 371
              ..:::.|....||...       |.||..||...|..| ||..|                   
plant   183 --CIKKQADVALEFAKPV-------VNCPSFGCNSELQRE-DCEGVLKPKQLDRMTMYKKASMIK 237

  Fly   372 ----------TCQN---------------------------GCGYVFCRNCLQGYHIG 392
                      ||.|                           .|||.||..|..|:|.|
plant   238 AKVLDFVCCTTCDNVMAKPDLIEYTKTFFVDAELSGVRKCTECGYCFCGECRAGWHSG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 23/111 (21%)
IBR <435..471 CDD:279784
AT5G07640NP_196381.1 RNase_H_like 24..122 CDD:387386 20/101 (20%)
RING_Ubox 155..202 CDD:388418 14/74 (19%)
IBR <275..298 CDD:388632 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.