DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and ARI1

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_567966.1 Gene:ARI1 / 829587 AraportID:AT4G34370 Length:597 Species:Arabidopsis thaliana


Alignment Length:239 Identity:63/239 - (26%)
Similarity:91/239 - (38%) Gaps:85/239 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 FPCASQ-------------HVTCIDCFRHYCRS--------RLGERQ-----FMPHPDFGYTLPC 310
            ||.:||             |:|.:||...:|.:        ::.|.|     .|.|       .|
plant   115 FPQSSQMSCDVCMEDLPGDHMTRMDCGHCFCNNCWTEHFTVQINEGQSKRIRCMAH-------QC 172

  Fly   311 PAGCEHSFIEEIHHFKLLTREEYD---RYQRFATEEYVLQAGGV-LCPQ-PGCGMGLLVEPD--C 368
            .|.|:...:.     .|::::..|   ::.|:..|.|:.....| .||. |.||..:..|.|  |
plant   173 NAICDEDIVR-----SLVSKKRPDLAAKFDRYLLESYIEDNRMVKWCPSTPHCGNAIRAEDDKLC 232

  Fly   369 RKVTCQNGCGYVFCRNCL-QGYHIGECLPEGTGASATNSCEYTVDPNRAAEARW--------DEA 424
             :|.|  .||..||.:|| |.:....||                        .|        ||:
plant   233 -EVEC--SCGLQFCFSCLCQAHSPCSCL------------------------MWELWRKKCRDES 270

  Fly   425 SNVT-IKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVC 467
            ..:. |.|.||.||||..|.|::|||..:.|.   ||..:||:|
plant   271 ETINWITVHTKLCPKCYKPVEKNGGCNLVRCI---CGQCFCWLC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 22/63 (35%)
IBR <435..471 CDD:279784 15/33 (45%)
ARI1NP_567966.1 IBR 194..256 CDD:214763 21/64 (33%)
IBR <284..313 CDD:279784 14/31 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.