DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT4G19670

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001078409.1 Gene:AT4G19670 / 827711 AraportID:AT4G19670 Length:532 Species:Arabidopsis thaliana


Alignment Length:482 Identity:105/482 - (21%)
Similarity:154/482 - (31%) Gaps:179/482 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DDL------KIIFAGKELSDATTIEQCDLGQ-QSVLHAIRLRPP----VQRQKIQSATLEEE--- 118
            |||      |::|.|     .:..|:.|||. .|.:..:..|..    :|.||.....:||.   
plant    51 DDLDDEFSVKMVFKG-----VSIFERGDLGSGYSGIGVVLERSGDLELIQVQKKLDFYVEESVAN 110

  Fly   119 --------EPSLSDEASKPLNET---LLDLQLESEERLNI----TDEERVRAKAHFFVHCSQCDK 168
                    |.:|.:..|..:..|   ||..|:..||:|.|    ...|||..|.          .
plant   111 YLALMDGLEVALQNNLSSVVAVTDSELLYNQITREEQLEIPLLVALRERVLEKT----------S 165

  Fly   169 LCNGKLRVRCALCKGGAFTVHRDPECWDDVLKSRRIPGHCESLEVACV------DNAAGDPPFAE 227
            ..||             |.:...|.|..|           |:|.:|.|      .|..||.|   
plant   166 NLNG-------------FVLKLAPFCDLD-----------EALSLAQVAVGIVSSNLDGDKP--- 203

  Fly   228 FFFKCAEHVSGGEKDFAAPLNLIKNNIKNVPCLACTDVSDTVLVFPCASQHVTCIDCFRHYCRSR 292
                                      |:|  |..|.:...:.::......|..|..|.:.|...:
plant   204 --------------------------IEN--CSICCEDRQSEMMLSLKCTHKFCSHCMKTYVEGK 240

  Fly   293 LGERQFMPHPDFGYTLPCP-AGCEHSFIEEIHHFKLLTREEYDRYQRFATEEYVLQA-------G 349
            :...: :|       :.|| ..|:|          .|:..|...:....|.:...:|       |
plant   241 VKTSE-VP-------IRCPQVQCKH----------YLSAAECKSFLPVTTFKSFEEANVCSKNNG 287

  Fly   350 GVLCPQPGCGMGLLVEP-DC---------RKVTCQNGCGYVFCRNCLQGYHIGECLPEGTGASAT 404
            .:.||.|.|  ..|::| :|         .....:|.| .|.|..|.:..    |:..|....|:
plant   288 KIYCPYPNC--SFLLDPQECLSSGRASSSSSTQSENSC-CVECPVCERFV----CVDCGVPWHAS 345

  Fly   405 NSC-EYTVDP-----------NRAAE-ARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTR 456
            .|| |:.:.|           :|.|. .||            :.|.:||...|...||.||.|. 
plant   346 MSCEEFQILPVDERYPDDITLHRLARYKRW------------RRCQQCRIMIELAQGCNHMTCR- 397

  Fly   457 AGCGFEWCWVCQTEW---TRDCMGAHW 480
              ||.|:|:.|..|:   .:.|..|.|
plant   398 --CGHEFCYSCGAEYREGQQTCTCAFW 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563 11/35 (31%)
parkin_N 32..101 CDD:176393 11/39 (28%)
IBR 334..390 CDD:214763 15/72 (21%)
IBR <435..471 CDD:279784 14/35 (40%)
AT4G19670NP_001078409.1 RNase_H_like 76..173 CDD:301345 25/119 (21%)
IBR 273..348 CDD:214763 17/81 (21%)
IBR 358..413 CDD:279784 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.