DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT3G45580

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_190144.1 Gene:AT3G45580 / 823700 AraportID:AT3G45580 Length:408 Species:Arabidopsis thaliana


Alignment Length:432 Identity:94/432 - (21%)
Similarity:154/432 - (35%) Gaps:138/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LEEEEPSLSDEASKPLNETLLDLQLESEERL---NITDEERVRAKAHFFVHCSQCDKLCNGKLRV 176
            :|||...:..|..|.:.....:::.:| .||   .:..||.|...|.|.|  :.|||..|...::
plant     1 MEEESTLVRAEDPKHVGRVSSEIKPDS-YRLYFKGLVSEETVELLAGFGV--AICDKDDNLLFQM 62

  Fly   177 RCALCKGGAFTVH--RDPECWDDVLKSRRIPGHCESLEVACVDNAAGDPPFAEFFFKCAEHVSGG 239
            :        ..||  |......:::..:|  |..|::.:. :||.:........|....|..:..
plant    63 K--------EQVHDSRVTVLEVEIMALKR--GLTEAVGLG-IDNISIYSDHYRIFELVMEKSASA 116

  Fly   240 EKDFAA----------------PLNLIKNNIK----------------NVP-----CLACTDVS- 266
            |::||.                |:.:.:|.||                ::|     |..|:|.: 
plant   117 EENFALLMDNVQHIRQRLTSSFPVLVTRNQIKFVYELAMETIVSEISIHIPDHDKTCSICSDDNF 181

  Fly   267 DTVLVFPCA-SQHVTCIDCFR----------------HY-CRSRLGERQFMPHPDFGYTLPCPAG 313
            :..|:|..| ..|..|::|.:                || |.|:|             ||   |.
plant   182 EPELMFSVALCGHEFCVECVKRHIEVRLLAGGVPRCLHYQCESKL-------------TL---AN 230

  Fly   314 CEHSFIEEIHHFKLLTREEYDRYQRFATEEYVLQAGGVLCPQPGCGMGLLV-------EPDCRKV 371
            |.:          |||.:....::....||.:.....|.||.|.|...:.|       ..|....
plant   231 CAN----------LLTSKLKAMWELRIEEESIPVEERVYCPNPRCSSLMSVTKLSNSTREDVTMR 285

  Fly   372 TCQNGCGYVFCRNCLQGYHIGECLPEGTGASATNSC-EY-TVDPNRAAEARWDEASNVTIKVST- 433
            :|.. ||..||.||...:|            :..|| :| ::.||..|:       ::.:|... 
plant   286 SCVK-CGEPFCINCKLPWH------------SNLSCNDYKSLGPNPTAD-------DIKLKALAN 330

  Fly   434 ----KPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEW 471
                :.|..|:...|...||||:.|.   ||.::|:.|..:|
plant   331 QKMWRQCENCKNVIELSEGCMHITCR---CGHQFCYKCGAKW 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 16/62 (26%)
IBR <435..471 CDD:279784 12/35 (34%)
AT3G45580NP_190144.1 RNase_H_like 74..154 CDD:301345 14/82 (17%)
IBR 241..308 CDD:214763 17/79 (22%)
IBR 326..369 CDD:279784 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.