DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT3G45570

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_190143.1 Gene:AT3G45570 / 823699 AraportID:AT3G45570 Length:312 Species:Arabidopsis thaliana


Alignment Length:191 Identity:44/191 - (23%)
Similarity:63/191 - (32%) Gaps:67/191 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 NVPCLACT-DVSDTVLVFPCA-SQHVTCIDCFR----------------HY-CRSRLGERQFMPH 301
            |..|..|: |..:...:|..| ..|..|::|.:                || |.|.|        
plant   160 NKTCSICSGDNIEPEQIFSVALCGHEFCMECVKQHIEVKLLSGGVPRCLHYQCESNL-------- 216

  Fly   302 PDFGYTLPCPAGCEHSFIEEIHHFKLLTREEYDRYQRFATEEYVLQAGGVLCPQPGCGMGLLV-- 364
                 ||   ..|.:          :||.:....::....||.:..|..|.||.|.|...:.|  
plant   217 -----TL---GSCGN----------ILTSKLKAMWELRIEEESIPVAERVYCPNPLCSSLMSVTK 263

  Fly   365 -----EPDCRKVTCQNGCGYVFCRNCLQGYHIGECLPEGTGASATNSC-EY-TVDPNRAAE 418
                 ..|....||.. ||..||.||...:|            :..|| :| ::.||..|:
plant   264 LSNSTREDVTMRTCVK-CGEPFCINCKLPWH------------SNLSCNDYKSLGPNPTAD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 18/62 (29%)
IBR <435..471 CDD:279784
AT3G45570NP_190143.1 RNase_H_like 32..144 CDD:417494
RING_Ubox 163..212 CDD:418438 10/48 (21%)
IBR 231..298 CDD:214763 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.