DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT3G45480

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_190134.2 Gene:AT3G45480 / 823688 AraportID:AT3G45480 Length:382 Species:Arabidopsis thaliana


Alignment Length:341 Identity:67/341 - (19%)
Similarity:121/341 - (35%) Gaps:105/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LRVRCALCKGGAFTVHR------DPECWDDVLKSRRIPGHCESLEVACVDNAAGDPPFAEFFFKC 232
            :.::..|.|..:|.::.      :||.::.|: .|.:|   :..::|.:                
plant    63 MALKLGLTKAVSFRINHISMFFDNPEIFELVM-GRSVP---KDKKIALI---------------- 107

  Fly   233 AEHVSGGEKDFAA--PLNLIKNNIKNVPCLAC-TDVSDTVLVFP----CAS-------------- 276
            .:.|....:.|::  |..:..|.||.|..||. |.||:..:..|    |.:              
plant   108 MDEVQRIRQQFSSSIPFLVASNEIKFVYKLAKETLVSNISIPRPQKKTCGNCFNDGIKGENMFSA 172

  Fly   277 ---QHVTCIDCFRHYCRSRLGERQFMPHPDFGYTLPCP-AGCEHSF-IEEIHHFKLLTREEYDRY 336
               .|..|::|.:.:....|.|         |....|| .||..:. :....|  |||.::.:.:
plant   173 DLCSHYFCVECMKEHIEVSLNE---------GGLPRCPHDGCTSNLTLRSCDH--LLTPKQREMW 226

  Fly   337 QRFATEEYVLQAGGVLCPQPGCGMGLLVEPDCRKVTCQNG-------CGYVFCRNCLQGYHIGEC 394
            ::...||.:.......||.|.| ..|:.:.:..:.|.::|       |...||.||...:|    
plant   227 EKRIKEESIPVCDRFHCPNPRC-WALMSKTELTESTEEDGVRRCCYKCRKHFCINCKVPWH---- 286

  Fly   395 LPEGTGASATNSC-EYTVDPNRAAEARWDEASNV--TIKVSTKPCP-KCRTPTERDGGCMHMVCT 455
                    :..|| |:...........|.:..:.  .||:|.:..| .||               
plant   287 --------SNLSCKEHKSSGREPITTVWRQCRSCLHKIKLSEERMPVTCR--------------- 328

  Fly   456 RAGCGFEWCWVCQTEW 471
               ||:::|:.|..:|
plant   329 ---CGYKFCYACGAQW 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 14/62 (23%)
IBR <435..471 CDD:279784 7/36 (19%)
AT3G45480NP_190134.2 RNase_H_like 59..139 CDD:301345 17/95 (18%)
IBR 224..291 CDD:214763 15/79 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.