DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT3G45470

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_190133.1 Gene:AT3G45470 / 823687 AraportID:AT3G45470 Length:222 Species:Arabidopsis thaliana


Alignment Length:252 Identity:53/252 - (21%)
Similarity:92/252 - (36%) Gaps:83/252 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 IKNVPCLACTD--------VSDTVL---VFPCASQHV----------TCIDCFRHYCRSRLGERQ 297
            :|...|:.|.:        |.|..|   .:||.:|.|          ||:|   :.|:.:|.   
plant     1 MKGETCVICLEETKADRMFVMDKCLHRHCYPCVNQLVEVKLRNGTVPTCLD---YECKLKLS--- 59

  Fly   298 FMPHPDFGYTLPCPAGCEHSFIEEIHHFKLLTREEYDRYQRFATEEYVLQAGGVLCPQPGCGMGL 362
                                 :|..  ||:|..:..:.::....||.:..|..:.||...|.. |
plant    60 ---------------------LENC--FKVLKPKVIELWKHMMKEESIPLAKRIYCPYINCST-L 100

  Fly   363 LVEPDCRKVTCQNG-----CGYVFCRNCLQGYHIGECLPEGTGASATNSCEY-TVDPNRAAEARW 421
            :.:.:..:....|.     |..:.|.:|...:|           |..:..|| .:.|:...:   
plant   101 MSKTEISRSNKSNDRACIKCSGLVCIDCKVPWH-----------SDLSCAEYKKLHPDPVLD--- 151

  Fly   422 DEASNVTIKV-----STKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEWTR 473
                ::|:|:     ..:.|.|||...|.:.||.||.|.   ||:::|:.|..||.:
plant   152 ----DLTLKLLANDQKWRQCVKCRHLIELNQGCNHMTCR---CGYQFCYKCGVEWKK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 11/60 (18%)
IBR <435..471 CDD:279784 14/35 (40%)
AT3G45470NP_190133.1 IBR 73..138 CDD:214763 13/76 (17%)
IBR 153..202 CDD:279784 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.