DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT3G43180

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_189904.1 Gene:AT3G43180 / 823392 AraportID:AT3G43180 Length:191 Species:Arabidopsis thaliana


Alignment Length:78 Identity:17/78 - (21%)
Similarity:30/78 - (38%) Gaps:22/78 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 CGYVFCRNCLQGYHIGECLPEG-TGASATNSCEYTVDPNRAAEARWDEASNVTIKVSTKPCPKCR 440
            ||:.||.:|:: .||...|.|| ......:.|||                    |::.:.|....
plant    78 CGHQFCVDCVK-QHIESRLLEGCVPRCPHDQC
EY--------------------KLTFRSCANLL 121

  Fly   441 TPTERDGGCMHMV 453
            ||..:....::::
plant   122 TPKTKSDSSIYLL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 5/12 (42%)
IBR <435..471 CDD:279784 3/19 (16%)
AT3G43180NP_189904.1 RING_Ubox 59..108 CDD:327409 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.