DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and ARI3

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_189408.1 Gene:ARI3 / 822393 AraportID:AT3G27710 Length:537 Species:Arabidopsis thaliana


Alignment Length:269 Identity:75/269 - (27%)
Similarity:98/269 - (36%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 FKCAEHVSGGEKDFAAPLNLIKNNIKNVPCLACTDVSDTVLVFPCASQHVTCIDCFRHYCRSRLG 294
            |.||     |...|...|...|..:|...|:.....|:.:....|.  |..|.||:..:...::.
plant   100 FSCA-----GLTVFVPSLVTSKKTMKCDVCMEDDLPSNVMTRMECG--HRFCNDCWIGHFTVKIN 157

  Fly   295 ERQ-----FMPHPDFGYTLPCPAGCEHSFIEEIHHFKLLTREEYDRYQRFATEEYVLQAGGV-LC 353
            |.:     .|.|       .|.|.|:...:.     ||::.|..|||.||..|.||.....| .|
plant   158 EGESKRILCMAH-------ECKAICDEDVVR-----KLVSPELADRYDRFLIESYVEDNNMVKWC 210

  Fly   354 P-QPGCGMGL--------LVEPDCRKVTCQNGCGYVFCRNCLQGYHIGECLPEGTGASATNSCEY 409
            | :|.||..:        :||..|       .||..||.:||...| ..|           ||  
plant   211 PSKPHCGSAIRKIEDGHDVVEVGC-------SCGLQFCFSCLSESH-SPC-----------SC-- 254

  Fly   410 TVDPNRAAEARW--------DEASNVT-IKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCW 465
                     ..|        ||:..|. |.|:||.||||..|.::..||..|.|.   ||..:||
plant   255 ---------LMWKLWKKKCEDESETVNWITVNTKLCPKCSKPIQKRDGCNLMTCK---CGQHFCW 307

  Fly   466 VCQTEWTRD 474
            :|.....||
plant   308 LCGQATGRD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 23/65 (35%)
IBR <435..471 CDD:279784 14/35 (40%)
ARI3NP_189408.1 RING-HC_RBR_TRIAD1_like 121..171 CDD:319537 10/58 (17%)
RING-HC finger (C3HC4-type) 121..171 CDD:319537 10/58 (17%)
IBR 190..254 CDD:214763 25/82 (30%)
IBR <277..311 CDD:366672 16/36 (44%)
COG4026 <431..519 CDD:226513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.