DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT3G14250

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_188042.2 Gene:AT3G14250 / 820645 AraportID:AT3G14250 Length:303 Species:Arabidopsis thaliana


Alignment Length:230 Identity:47/230 - (20%)
Similarity:85/230 - (36%) Gaps:46/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 CLACTDVSDTVLVFPCASQ--HVTCIDCFRHYCRSRLGERQFMPHPDFGYTLPCP-AGCEHSFIE 320
            |:.|.|...:..:|...:.  |..|.||...|..:::.|.        ...:.|| ..|.. .||
plant    95 CMICMDEKPSSDIFRGTTNCTHAYCTDCTVRYVATKIKEN--------ASRIKCPDVECTR-LIE 150

  Fly   321 EIHHFKLLTREEYDRYQRFATEEYVLQAGGVLCPQPGC---------GMGLLVEPDCRKVTCQNG 376
            ......|:.::.:||:::...|..:.......||...|         |...:.:.:||      .
plant   151 PYTCRDLIPKDVFDRWEKILCESLISSWDKFYCPFKDCSAMMVNNENGDANVTQTECR------S 209

  Fly   377 CGYVFCRNCLQGYHIGECLPEGTGASATNSCEYTVDPNRAAEARWDEASNVTIKVST----KPCP 437
            |..:||..|...:|.|            ..|:.........:...||...:.|:::.    :.||
plant   210 CHRLFCVQCKVTWHAG------------IGCDEFQRFGNTKKKSSDEDDALLIQMAKNKQWRRCP 262

  Fly   438 KCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEWT 472
            .|:...::..||.|:.|.   ||:::|:.|.:.|:
plant   263 SCKFYVDKVEGCQHIKCR---CGYQFCYGCGSVWS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 13/64 (20%)
IBR <435..471 CDD:279784 11/35 (31%)
AT3G14250NP_188042.2 IBR 164..228 CDD:214763 15/81 (19%)
IBR 251..293 CDD:279784 11/44 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.