DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and ARI10

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_180735.1 Gene:ARI10 / 817733 AraportID:AT2G31760 Length:514 Species:Arabidopsis thaliana


Alignment Length:354 Identity:84/354 - (23%)
Similarity:129/354 - (36%) Gaps:112/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ETLLDLQLESEERLN----ITDEERVRAKAHFFVHCSQCDKLCNGKLRVRCALCKGGAFTVHRDP 192
            |.:|.||.:..||::    ::..|.:....|:        ..|..||                :.
plant    49 EEILKLQRDDIERVSTILFLSQVEAIVLLLHY--------HWCVSKL----------------ED 89

  Fly   193 ECWDDVLKSRRIPGHCESLEVACVDNAAGDPPFAEFFFKCAEHVSGGEKDFAAPLNLIKNNIKNV 257
            |.:.|..:.|:..|   .|:...||                  |:|.|.|....:.......|.:
plant    90 EWFTDEERIRKTVG---ILKEPVVD------------------VNGTEVDIQCGICFESYTRKEI 133

  Fly   258 PCLACTDVSDTVLVFPCASQHVTCIDCFRHYCRSRLGE-----RQFMPHPDFGYTLPCPAGCEHS 317
            ..::|              .|..|..|:..|..:::.:     |...|.|.      |.|.....
plant   134 ASVSC--------------GHPYCKTCWTGYITTKIEDGPGCLRVKCPEPS------CYAVVGQD 178

  Fly   318 FIEEIHHFKLLTREEYDRYQRFATEEYVLQAGGVL--CPQPGCGMGL-LVEPDCRKVTCQNGCGY 379
            .|:|:     ..:::.|:|.|:....|| :.|..:  ||.|||...: ..|.....|.|.  |.|
plant   179 MIDEV-----TEKKDKDKYYRYFLRSYV-EDGKKMKWCPSPGCECAVEFGESSGYDVACL--CSY 235

  Fly   380 VFCRNCLQGYHIGECLPEGTGASATNSCEYTVDPNRAAEARW-----DEASNVT-IKVSTKPCPK 438
            .||.||.:..|            :...|| ||       ::|     ||:.|.. |..::|||||
plant   236 RFCWNCSEDAH------------SPVDCE-TV-------SKWIFKNQDESENKNWILANSKPCPK 280

  Fly   439 CRTPTERDGGCMHMVCTRAGCGFEWCWVC 467
            |:.|.|:..||.||.|: |.||..:||:|
plant   281 CKRPIEKSHGCNHMTCS-ASCGHRFCWIC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 20/58 (34%)
IBR <435..471 CDD:279784 18/33 (55%)
ARI10NP_180735.1 RING-HC_RBR_TRIAD1_like 121..171 CDD:319537 9/69 (13%)
IBR 190..251 CDD:214763 21/75 (28%)
IBR <273..312 CDD:396187 19/37 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11685
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.