DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT2G26130

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_180182.2 Gene:AT2G26130 / 817153 AraportID:AT2G26130 Length:398 Species:Arabidopsis thaliana


Alignment Length:263 Identity:66/263 - (25%)
Similarity:102/263 - (38%) Gaps:61/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DFAAPLNLIKNN-IKNVP-----CLAC--TDVSDTVLVFPCASQHVTCIDCFRHYCRSRLGERQF 298
            |||  :..|.:. |.::|     |..|  .|::...:.....|.|:.|.:|.:.:...||.|   
plant   138 DFA--IEAISSEIIIDIPAQKETCNICLNDDINADQMFSVDKSGHMCCSECVKRHIEVRLLE--- 197

  Fly   299 MPHPDFGYTLPCPAGCEHSFIEEIHHFKLLTREEYDRYQRFATEEYVLQAGGVLCPQPGC----- 358
                  |..:.||....:|.:..:....|||.:....:::...:|.:.....|.||.|.|     
plant   198 ------GSLITCPHYRCNSLLTSVRCGNLLTPKLNKMWEQKTKDELIPVMDRVYCPNPRCSTLMS 256

  Fly   359 -----GMGLLVEPDCRKVTCQNGCGYVFCRNCLQGYHIGECLPEGTGASATN-SC-EY-TVDPNR 415
                 |:.:.|...|.|      ||..||..|...:|             .| || || |:.||.
plant   257 ETELSGLNIGVRRCCVK------CGEPFCVKCKVSWH-------------NNLSCDEYKTLHPNP 302

  Fly   416 AA-EARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEWTRDCMGAH 479
            .. :.|..:.:|   :.|.:.|.||:...|...||:.:||.   ||..:|:.|..: ..||.  |
plant   303 TENDGRLRDLAN---EKSWRQCSKCKHMIELSSGCISVVCR---CGHTFCYQCGAD-AGDCF--H 358

  Fly   480 WFG 482
            ..|
plant   359 GLG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 15/65 (23%)
IBR <435..471 CDD:279784 12/35 (34%)
AT2G26130NP_180182.2 RNase_H_like 60..>114 CDD:301345
IBR 227..292 CDD:214763 17/83 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.