DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT2G25360

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_180108.1 Gene:AT2G25360 / 817075 AraportID:AT2G25360 Length:373 Species:Arabidopsis thaliana


Alignment Length:275 Identity:64/275 - (23%)
Similarity:105/275 - (38%) Gaps:67/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 EFFFKCAEHVSGGEKDFAAPLN----LIKNNIKNVPCLACTDVSDTVLVF----PCASQHVTCID 283
            |..:..|:.::..:.:||..|.    :.::::|...|..|.:.::...:|    .|..:|  |..
plant    54 EMTYTDADLIALNDVNFAFKLAREAIVSRDDVKAEICSICFEETEGERMFFTTEKCVHRH--CFP 116

  Fly   284 CFRHYCRSRLGERQFMPHPDFGYTLP-C-PAGCEHSFIEEIHHFKLLTREEYDRYQRFATEEYVL 346
            |.:.|...:|          ...|:| | ..||:.....| ...|:||.|..:.:::...|:.:.
plant   117 CVKQYVEVKL----------LSGTVPTCLDDGCKFKLTLE-SCSKVLTLELIEMWKQKMKEDSIP 170

  Fly   347 QAGGVLCPQPGCGM-----GLLVEPD-CRKVTCQNGCGYVFCRNCLQGYHIGECLPEGTGASATN 405
            .|..:.||.|.|.|     .|..|.| ....:|...|| :||.:|....|           |..:
plant   171 AAERIYCPYPNCSMLMSKTELSSESDLSNDRSCVKCCG-LFCIDCKVPSH-----------SDLS 223

  Fly   406 SCEYTV---DP--------NRAAEARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGC 459
            ..||..   ||        :.|.:.:|            :.|..||...|....|.||.|.   |
plant   224 CAEYKKLHHDPLVDELKLKSLAKDKKW------------RQCKMCRHMIELSHACNHMTCR---C 273

  Fly   460 GFEWCWVCQTEWTRD 474
            |:::|:.|:.||..|
plant   274 GYQFCYQCEVEWKND 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 16/61 (26%)
IBR <435..471 CDD:279784 12/35 (34%)
AT2G25360NP_180108.1 RNase_H_like 1..78 CDD:301345 5/23 (22%)
IBR 158..224 CDD:214763 18/77 (23%)
IBR 237..285 CDD:279784 14/62 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.