DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT2G21420

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_179737.1 Gene:AT2G21420 / 816681 AraportID:AT2G21420 Length:468 Species:Arabidopsis thaliana


Alignment Length:475 Identity:107/475 - (22%)
Similarity:156/475 - (32%) Gaps:152/475 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LQPDDLKIIFAGKELSDATTIEQCDLGQQSVLHAIRLRPPVQRQKIQSATLEEEEPSLSDEASKP 129
            ::..||.:|...:.:..|||.:                  :...|.:..::..|..|.|:..:..
plant     1 MEKHDLTLISKKRRIDFATTGD------------------IPNLKGEGVSMVAESASASNIFADS 47

  Fly   130 LNETLLDLQLESEERLNITDEERVRAKAHFFVHCSQCD----------KLCNG-------KLRVR 177
            |...|....|.|:|  ..||.|.: .||.|.:  :.||          |..||       ::.::
plant    48 LVYRLFFKGLVSDE--TTTDMEEI-VKAGFGI--AICDEANTLLYNMKKSLNGDDVINPEEVEIK 107

  Fly   178 CALCKGGAFTVHRDPE-------CWD----DVLKSRRIP---------------GHCESLEVACV 216
            ..:|   ...|....|       |.|    .:|..|..|               |...|.||..|
plant   108 ALIC---VLNVSIQMELRNVMICCGDYQIFQILTGRGKPQQNIVHLVEQVQHLRGKLSSTEVVLV 169

  Fly   217 DNAAGDPPFAEFFFKCAEHVSGGEKDFAAPLNLIKNNIKNVPCLACTDVSDTVLVF---PCASQH 278
                   |.|:......|.: |||                 .|..|.:.:|...:|   .|.  |
plant   170 -------PRADVIILAIEAI-GGE-----------------TCCICRENTDADRMFFTENCF--H 207

  Fly   279 VTCIDCF-RHYCRSRLGERQFMPHPDFGYTLPC---PAGCEHSFIEEIHHFKLLTREEYDRYQRF 339
            ..|..|. ||..|..|          .|.:..|   |...|.:| |...  |:||....:.::|.
plant   208 RQCFSCVNRHVQRMLL----------CGISPTCLHFPCNSELTF-ESCS--KVLTPNLIEFWKRK 259

  Fly   340 ATEEYVLQAGGVLCPQPGCGM-----GLLVEPDCRKVTCQNGCGYVFCRNCLQGYHIGECLPEGT 399
            ..|:.|..|..:.||...|.|     .|..|.|...|.....|..:||.:|.        :|...
plant   260 IEEDLVPAADKIYCPYRRCSMLMSKTALSRETDQSNVRACIKCCRLFCIDCK--------VPSHA 316

  Fly   400 GASATNSCEYTVDP-------NRAAEARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRA 457
            |.|..:..:...||       :.|.:.:|            :.|.:|....|...||.|:.|.  
plant   317 GLSCVDYKKLNPDPLYDVKLKSLANKKKW------------RQCVQCSNLVELFEGCNHITCR-- 367

  Fly   458 GCGFEWCWVCQTEWT-RDCM 476
             ||||:|:||..||. |.|:
plant   368 -CGFEFCYVCGKEWNQRGCL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563 6/31 (19%)
parkin_N 32..101 CDD:176393 6/35 (17%)
IBR 334..390 CDD:214763 16/60 (27%)
IBR <435..471 CDD:279784 14/35 (40%)
AT2G21420NP_179737.1 RNase_H_like 101..171 CDD:301345 13/79 (16%)
IBR 254..320 CDD:214763 18/73 (25%)
IBR 337..380 CDD:279784 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.