DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment park and AT2G16520

DIOPT Version :9

Sequence 1:	NP_730600.1	Gene:	park / 40336	FlyBaseID:	FBgn0041100	Length:	482	Species:	Drosophila melanogaster
Sequence 2:	NP_179245.1	Gene:	AT2G16520 / 816151	AraportID:	AT2G16520	Length:	99	Species:	Arabidopsis thaliana

Alignment Length:	63	Identity:	16/63 - (25%)
Similarity:	26/63 - (41%)	Gaps:	18/63 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   107 RQKIQSATLEEEEPSLSDEASKPLNETLLDLQLES-EERLNITDEERVRAKAHFFVHCSQCDK 168
            ||::.|:|     |.|  ......|:...:|.||: ...::|:.||:...          |||
plant    53 RQQLTSST-----PLL--VTGNQTNKLAYELALETLVSEISISIEEKALT----------CDK 98

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
park	NP_730600.1	UBQ	30..97	CDD:214563
		parkin_N	32..101	CDD:176393
		IBR	334..390	CDD:214763
		IBR	<435..471	CDD:279784
AT2G16520	NP_179245.1	RNase_H_like	<1..77	CDD:417494	7/30 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1140368at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010