DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and ari-2

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster


Alignment Length:363 Identity:87/363 - (23%)
Similarity:139/363 - (38%) Gaps:89/363 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 DEERV---RAKAHFFVHCSQC------DKLCNGK-------LRVRCALCKGGAFTVHRDPECWDD 197
            |.||:   ||...:|.:  :|      :||.|.:       |::..:|.| .....|:    |::
  Fly    31 DVERLDPKRADPEYFEY--ECLTVEDIEKLLNERVEKLNTILQITPSLAK-VLLLEHQ----WNN 88

  Fly   198 VL---KSRR------IPGHCESLEVACVDNAAGDPPFAEFFFKCAEHV---SGGEKDFAAPLNLI 250
            |.   |.|:      :....:...||..|.|:.....|.     |:.:   |.|.|..|:.....
  Fly    89 VAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAAAS-----AQLLRLGSSGYKTTASATPQY 148

  Fly   251 KNNIKNVPCLACTDVSDTVLVFPCASQHVTCIDCFRHYCRSRLGERQFMPHPDFGYTLPCPAGCE 315
            ::.:  .|..|.:.:.|......|.  |..|.||:..|..:::.:       .....:.|.|...
  Fly   149 RSQM--CPVCASSQLGDKFYSLACG--HSFCKDCWTIYFETQIFQ-------GISTQIGCMAQMC 202

  Fly   316 HSFIEEIHHFKLLTREEY-DRYQRFATEEYVLQAGGV-LCPQPGCGMGLLV---EPDCRKVTCQN 375
            :..:.|.....|:||... |:||:||.::||.....: .||.|.|  .::|   |...::..|: 
  Fly   203 NVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNC--QIIVQSSEISAKRAICK- 264

  Fly   376 GCGYVFCRNCLQGYHIGECLPEGTGASATNSCEYTVDPNRAAEARW-------DEASNVTIKVST 433
            .|...||..|...||            |...|:..        .:|       .|.:|. |...|
  Fly   265 ACHTGFCFRCGMDYH------------APTDCQVI--------KKWLTKCADDSETANY-ISAHT 308

  Fly   434 KPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEW 471
            |.||||....|::|||.||.|  ..|..::||:|..:|
  Fly   309 KDCPKCHICIEKNGGCNHMQC--FNCKHDFCWMCLGDW 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 18/59 (31%)
IBR <435..471 CDD:279784 15/35 (43%)
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 11/63 (17%)
IBR 222..284 CDD:214763 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.