DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and ari-1

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001245736.1 Gene:ari-1 / 32796 FlyBaseID:FBgn0017418 Length:503 Species:Drosophila melanogaster


Alignment Length:279 Identity:77/279 - (27%)
Similarity:112/279 - (40%) Gaps:75/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 FFKCAEHVSGGEKDFAAPLN---LIKNNIKNVPCLACTDV-----SDTVLVFPCASQHVTCIDCF 285
            |||||..::        |.|   .||.......|..|...     .|::....|.  |..|:.|:
  Fly   105 FFKCAHVIN--------PFNATEAIKQKTSRSQCEECEICFSQLPPDSMAGLECG--HRFCMPCW 159

  Fly   286 RHYCRSRLGERQFMPHPDFGYTLPCPA-GCEHSFIEEIHHFKLLTREEYD-RYQRFATEEYVLQA 348
            ..|..:::...      ..|.|:.|.| ||: ..::::....|:|..... :||:..|..:| :.
  Fly   160 HEYLSTKIVAE------GLGQTISCAAHGCD-ILVDDVTVANLVTDARVRVKYQQLITNSFV-EC 216

  Fly   349 GGVL--CPQPGCGMGLLV---EPDCRKVTCQNGCGYVFCRNCLQGYHIGECLPEGTGASATNSCE 408
            ..:|  ||...|...:.|   ||  |:|.|:  ||:|||..|.:.:|                  
  Fly   217 NQLLRWCPSVDCTYAVKVPYAEP--RRVHCK--CGHVFCFACGENWH------------------ 259

  Fly   409 YTVDPNRAAEARW-----------DEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFE 462
               ||   .:.||           .|.|| .|..:||.||:|....|:||||.||||....|..|
  Fly   260 ---DP---VKCRWLKKWIKKCDDDSETSN-WIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNE 317

  Fly   463 WCWVCQTEWTRDCMGAHWF 481
            :||||...|  :..|:.|:
  Fly   318 FCWVCLGSW--EPHGSSWY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 20/61 (33%)
IBR <435..471 CDD:279784 18/35 (51%)
ari-1NP_001245736.1 IBR 204..264 CDD:214763 23/88 (26%)
IBR <286..326 CDD:279784 20/39 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.