DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and AT2G26135

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_973536.1 Gene:AT2G26135 / 2745561 AraportID:AT2G26135 Length:384 Species:Arabidopsis thaliana


Alignment Length:277 Identity:59/277 - (21%)
Similarity:103/277 - (37%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 CVDN-------AAGDPPFAEFFFKCAEHVSGGEKDFAAPLNLIKNNIKNVPCL-----ACT---- 263
            |.||       .....|..|........|.|..|.|.:.:.:    :.:||.|     .||    
plant    98 CCDNNQIFEWVMGRSTPQEENIAMLIRDVQGIRKQFTSSIAV----LIDVPALFHPKKTCTICFD 158

  Fly   264 -DVSDTVLVFPCASQHVTCIDCFRHYCRSRLGERQFMPHPDFGYTLPCPAGCEHSFIEEIHHFKL 327
             |::..::.:.....|:.|.:|.:.:....|.:         |..:.||:....|.:.......:
plant   159 DDINADMMFYIDQCGHMFCSECVKRHIEVSLLQ---------GSLITCPSYRCKSKLTYGSCVNI 214

  Fly   328 LTREEYDRYQRFATEEYVLQAGGVLCPQPGCGMGLLVEPDCRKVT----CQNGCGYVFCRNCLQG 388
            ||.:..:.:.:...|:.:.....|.||.|.|. .|:...:..::|    |...||..||..|...
plant   215 LTPKVKEMWIQRMGEDSIPVTDRVYCPNPTCS-ALMSVTELDQLTGSKRCCVKCGESFCIKCKVP 278

  Fly   389 YHIGECLPEGTGASATNSCE--YTVDPNRAA-EARWDEASNVTIKVSTKPCPKCRTPTERDGGCM 450
            :|            ...||:  ..:..||.. :.:.:|.:|   :.|.:.|.||:...|...||:
plant   279 WH------------DNLSCKRYKKLHSNRTTNDKQLNELAN---QESWRQCSKCKHMIELTQGCV 328

  Fly   451 HMVCTRAGCGFEWCWVC 467
            .::|.   ||.|:|:.|
plant   329 RVICR---CGHEFCYGC 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 14/59 (24%)
IBR <435..471 CDD:279784 12/33 (36%)
AT2G26135NP_973536.1 RNase_H_like 73..>135 CDD:301345 9/36 (25%)
IBR 221..285 CDD:214763 15/76 (20%)
IBR 286..346 CDD:279784 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.