DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and tag-314

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_872234.4 Gene:tag-314 / 179455 WormBaseID:WBGene00008871 Length:404 Species:Caenorhabditis elegans


Alignment Length:235 Identity:43/235 - (18%)
Similarity:73/235 - (31%) Gaps:96/235 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PLNLIKNNIKN-------VPCLACTDVSDTVLVFPCASQHVTCIDCFRHYCRSRL---GERQFMP 300
            |::|   |:|.       |.|..| .:.|.:.:......||.|:.|...|.::::   |      
 Worm    24 PMDL---NLKEKKPTFTIVGCELC-QIKDEIRIILRQCGHVVCLPCVLEYIKNKIIVDG------ 78

  Fly   301 HPDFGYTLPCPAGCEHSFIEEIHHFKLLTREE--YDRYQRFATEEYVLQAGGVLCPQPGCGMGLL 363
            ||.|    .||....::.:.|.....:|..:|  .:||.......|:...               
 Worm    79 HPRF----KCPLSTCNAVVHENDINAVLDEKEPALERYMSIVHRRYLQYK--------------- 124

  Fly   364 VEPDCRKVTCQNGCGYVFCRNCLQGYHIGECLPEGTGASATNSCEYTVDPNRAAEARWDEASNVT 428
                      ||            .:.|...||                           :|:: 
 Worm   125 ----------QN------------KHSIMAALP---------------------------SSDI- 139

  Fly   429 IKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQ 468
                 |.||.||:......||.:::|..:.|...:||:|:
 Worm   140 -----KRCPLCRSIYMHVVGCNYVICANSACNTAFCWLCE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 5/55 (9%)
IBR <435..471 CDD:279784 11/34 (32%)
tag-314NP_872234.4 InsA 48..>90 CDD:226202 12/51 (24%)
IBR 119..176 CDD:279784 19/126 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.