DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment park and RNF217

DIOPT Version :9

Sequence 1:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_011533796.1 Gene:RNF217 / 154214 HGNCID:21487 Length:567 Species:Homo sapiens


Alignment Length:418 Identity:90/418 - (21%)
Similarity:134/418 - (32%) Gaps:139/418 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PLNETLLDLQLESEE-------RLNITDEE-----------RVR-------------------AK 156
            |||...|.||||.||       |....||:           |.|                   ||
Human    95 PLNPQTLPLQLELEEEEEEAGDRKEGGDEQQEAPPGEELEPRTRVGAADGLVLDVLGQRRPSLAK 159

  Fly   157 AHFF--VHCSQCD-KLCNGKLRVRCALCKGGAFTVHRDPECWDDVLKSRRIPGHCESL------- 211
            ...|  |:|.:.| .......::.......||..|...|..... ..|.|:....:||       
Human   160 RQVFCSVYCVESDLPEAPASEQLSPPASPPGAPPVLNPPSTRSS-FPSPRLSLPTDSLSPDGGSI 223

  Fly   212 --------EVACVDNAAGDPPFAEFFFKCAEHVSGGEKDFAAPLNLIKNNIKNVPCLACTDVSDT 268
                    |...:.:..|.||::..         ||..|...||.::.       |..|.: ...
Human   224 ELEFYLAPEPFSMPSLLGAPPYSGL---------GGVGDPYVPLMVLM-------CRVCLE-DKP 271

  Fly   269 VLVFPCASQHVTCIDCFRHY--CRSRLGERQFMPHPDFGYTLPCPAGCEHSFIEEIHHFKLLTRE 331
            :...||..:.| |.:|.:.|  .:.:||:.:          :.||......|:||......||.|
Human   272 IKPLPCCKKAV-CEECLKVYLSAQVQLGQVE----------IKCPITECFEFLEETTVVYNLTHE 325

  Fly   332 EYDRYQRFATEEYVLQAGGVLCPQPGCGMGLLVEPDCR---------------------KVTCQN 375
            :..:|      :|.|:.|.:......|       |.|:                     |:.|..
Human   326 DSIKY------KYFLELGRIDSSTKPC-------PQCKHFTTFKKKGHIPTPSRSESKYKIQCPT 377

  Fly   376 GCGYVFCRNCLQGYHIGECLPEGTGASATNSCEYTVDPNRAAEARWDEASNVTI-KVSTKPCPKC 439
             |.:|:|..|...:|.|           .|..||.......  ..|  ||.:.. :.:.:.||||
Human   378 -CQFVWCFKCHSPWHEG-----------VNCKEYKKGDKLL--RHW--ASEIEHGQRNAQKCPKC 426

  Fly   440 RTPTERDGGCMHMVCTRAGCGFEWCWVC 467
            :...:|..||.||.|::  |...:|:.|
Human   427 KIHIQRTEGCDHMTCSQ--CNTNFCYRC 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 13/76 (17%)
IBR <435..471 CDD:279784 13/33 (39%)
RNF217XP_011533796.1 IBR 329..396 CDD:214763 15/91 (16%)
InsA 338..>382 CDD:226202 6/51 (12%)
IBR <418..456 CDD:279784 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140368at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.