DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42337 and Arid4b

DIOPT Version :9

Sequence 1:NP_001246858.1 Gene:CG42337 / 40335 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_008769986.1 Gene:Arid4b / 84481 RGDID:619919 Length:1319 Species:Rattus norvegicus


Alignment Length:319 Identity:66/319 - (20%)
Similarity:116/319 - (36%) Gaps:79/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 DVEVEAVAESPAQRLTTSPPMISATGTDSGISNCSTRARSDSSQSTPVYSGEYPVNMSVESASCV 272
            |.:.||.|         |||   ....|.|....|.:..::....:|        ||.:|.    
  Rat   948 DSDTEAAA---------SPP---HAAPDEGTVEESLQTVAEEESCSP--------NMELEK---- 988

  Fly   273 PYHCPADARDYEEEEHQPPVTAEVRRADTPLDITDDISATSPVAADEVKPTAPTSSQVAKSAETN 337
            |.....|::..||:    |:....|:.:.|...::.:..|.|..     |.:|:|..|.:::   
  Rat   989 PLPTSVDSKPVEEK----PLEVSDRKTEFPSSGSNSVLNTPPTT-----PESPSSVTVTETS--- 1041

  Fly   338 LQPDSAASLDVPTTPQDTSGDPITEAADERPE----HARQQQHPVTNNWSPTTRRPRTPPAPQNS 398
             |..|:.::.||..|.......|....|...|    ....|......|               :|
  Rat  1042 -QQQSSVTVSVPLPPNQEEVRSIKSETDSTIEVDSVVGELQDLQSEGN---------------SS 1090

  Fly   399 PIGFGQNASVPPALAHLLQQQQQQQLQLQQQ--QQQQQVGNLKRCATSGKNRSSHNRIIECDLIP 461
            |.||  ||||..:.::..:.:..::....|:  :..|.||     ::|.|.:.||...:      
  Rat  1091 PAGF--NASVSSSSSNQPEPEHPEKACTGQKRVKDTQGVG-----SSSKKQKRSHKATV------ 1142

  Fly   462 SKKSKRKSVKKQAGEIENMEAVEPIVREQIRDIKPLPGFLQAFGSTEIGRFSERFLQTP 520
             ..:|:|.....:.:.|::.|.|.:.:.|.  ||.:|..::...|....|     :|:|
  Rat  1143 -VNNKKKGKGTNSSDSEDLSAGESVTKTQA--IKSVPTGMKTHNSKSPAR-----IQSP 1193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42337NP_001246858.1 None
Arid4bXP_008769986.1 TUDOR 58..113 CDD:197660
RBB1NT 169..262 CDD:285392
ARID 311..394 CDD:198082
Tudor-knot 571..624 CDD:288553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.