DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42337 and arid3c

DIOPT Version :9

Sequence 1:NP_001246858.1 Gene:CG42337 / 40335 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_005165415.1 Gene:arid3c / 569444 ZFINID:ZDB-GENE-060526-12 Length:599 Species:Danio rerio


Alignment Length:440 Identity:82/440 - (18%)
Similarity:141/440 - (32%) Gaps:145/440 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 QHLSQQQLQHHPLPGTPKLEDPDVEVEAVAESPAQRLTTSPPMISATGTDSGISNCSTRARSDSS 250
            ::|.:||.....|....:..:.:.::.::.||..|:...:            ..:.....|...:
Zfish    49 ENLQRQQAARLALEEKLRQAEKEKDIRSMVESQIQQQALA------------FRHYQAAVRGAFA 101

  Fly   251 QSTPVYSGEYPVNMSVESASCVPYHCPADARDYEEEEHQPPVTAEVRRA--DTPLDITDDISATS 313
            ...|..|..:|:....||          |..|.::|:..|    |:.|.  |...|:.:|.|...
Zfish   102 AGVPNSSSGHPLERRAES----------DIDDEDDEDDDP----ELDRGMDDEERDMDEDDSMNE 152

  Fly   314 PVAADEVK-PTAPTSSQVAKSAETNLQPDSAASLDVPTTPQDTSGDPITEAADERPEHARQQQHP 377
            ....:::: |.|            :..|..|.......:|:.|            |.|..:.|.|
Zfish   153 GGGDEDLEGPLA------------HYPPRHAVYPGAGQSPKST------------PIHLSRVQPP 193

  Fly   378 VTNNWSPTTRRPRTPPAPQNSPIGFGQNASVPPALAHLLQQQQQQQLQLQQQQQQQQVG------ 436
            .              |||        :.|..|.|||   .|.|.|..:...::|.:|.|      
Zfish   194 Y--------------PAP--------RQAESPSALA---PQAQSQHHEWTYEEQFKQSGQGSGPG 233

  Fly   437 -NLKRCATS---GKNRSSHNRIIECDLIPSKKSKRKS--------VKKQAGEIENMEAVEPIVRE 489
             .||..:.:   |.:.|....:.|.|    ...|||.        ::|:...:..:    ||:.:
Zfish   234 RKLKDSSVAFGGGGSSSLIQELYELD----DDEKRKEFLDDLFSFMQKRGTPVNRI----PIMAK 290

  Fly   490 QIRDIKPL------PGFLQAFGSTEIGRFSERFLQTPESLVERLAEEYAGSAPNNCPSHSAGGYI 548
            |:.|:..|      .|.|....:.:|.|...:.|..|.|:.                  ||...:
Zfish   291 QVLDLYTLYKLVTEKGGLVEVINKKIWREITKGLNLPTSIT------------------SAAFTL 337

  Fly   549 ESPAMATHNY-YPYEEQNQG-------------GYPRNRMRDYGYEIPDY 584
            .:..|   .| ||||.:.:|             .....|.:.||..:.:|
Zfish   338 RTQYM---KYLYPYECEKRGLSSPGELQAAIDSNRREGRRQSYGSTLFNY 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42337NP_001246858.1 None
arid3cXP_005165415.1 BRIGHT 262..354 CDD:128777 24/116 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.