DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42337 and Arid3c

DIOPT Version :9

Sequence 1:NP_001246858.1 Gene:CG42337 / 40335 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001167452.1 Gene:Arid3c / 502946 RGDID:1560943 Length:410 Species:Rattus norvegicus


Alignment Length:138 Identity:38/138 - (27%)
Similarity:51/138 - (36%) Gaps:15/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 AGPTPHYAP-PGRSSTPAPNRTVLPPSYLEPLRSYSAEQQHLSQQQHLSQQQLQHHPLPGTPKLE 205
            |||||..|| |..|..|||..|...|...:  .|.|....|...|...|..:.:...:| .|:|.
  Rat   236 AGPTPRGAPGPASSHGPAPTTTPNCPGSTQ--GSASGLPAHACAQLSPSPVKKEESGIP-PPRLA 297

  Fly   206 DP-DVEVEAVAES------PAQRLT----TSPPMISATGTDSGISNCSTRARSDSSQSTPVYSGE 259
            .| .:.:||..|.      |.:|..    ..||.:.||.:.........|............||.
  Rat   298 IPVGLALEAAREKLAPEEPPEKRAVLMGPMDPPRLGATPSFLPRGKAPLREERLDGPLNLAGSGI 362

  Fly   260 YPVNMSVE 267
            ..:||::|
  Rat   363 SSINMALE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42337NP_001246858.1 None
Arid3cNP_001167452.1 BRIGHT 112..203 CDD:128777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.