DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42337 and retn

DIOPT Version :9

Sequence 1:NP_001246858.1 Gene:CG42337 / 40335 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_788434.1 Gene:retn / 45976 FlyBaseID:FBgn0004795 Length:911 Species:Drosophila melanogaster


Alignment Length:449 Identity:97/449 - (21%)
Similarity:133/449 - (29%) Gaps:186/449 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SFYDQHHSHHHPQHLTPTMSHYPPQPYRSGYTGYHTYGYGYGSSSSASYMPNYYRYAPYASPHYS 72
            |.|.|:.:.|:...:||...  |..|               |.....|.:. ...:|..|:...:
  Fly   407 SSYGQYEAMHNQMPMTPISR--PSLP---------------GGMQQMSPLA-LVTHAAVANNQQA 453

  Fly    73 Q--------HHQGMFTPA-GQ------QIIPSSVLHY------------PP---RPHPYQQLPQQ 107
            |        ||:.|..|| ||      |.|.|.::.|            ||   ..||:||...|
  Fly   454 QAAAAAAAAHHRLMGAPAFGQMPNLVKQEIESRMMEYLQLIQAKKEQGMPPVLGGNHPHQQQHSQ 518

  Fly   108 QQPHPQQSQPGYEPPPPLPYSSSASYQSRGFGAFAGPTPHYAPPGRSSTPAPNRTVLPPSYLEPL 172
            ||   ||.|                              |:                        
  Fly   519 QQ---QQQQ------------------------------HH------------------------ 526

  Fly   173 RSYSAEQQHLSQQQHLSQQQLQHHPLPGTPKLEDPDVEVE-------------AVAESPAQR--- 221
              :..:||..|||||..|||.|....|...|.|....:|.             :...||.||   
  Fly   527 --HQQQQQQQSQQQHHLQQQRQRSQSPDLSKHEALSAQVALWHMYHNNNSPPGSAHTSPQQREAL 589

  Fly   222 -LTTSPPMIS--------------ATGTDSGISNCSTRARSDSSQSTPVYSGEY---PVNMSVES 268
             |:.|||.::              ....|..:.......|..|....|.:...:   |.||:..:
  Fly   590 NLSDSPPNLTNIKREREREPTPEPVDQDDKFVDQPPPAKRVGSGLLPPGFPANFYLNPHNMAAVA 654

  Fly   269 ASCVPYHCPA-----DAR-------DYEEEEHQPPVTAEVRRADTP--------------LDITD 307
            |: ..:|.|:     ||.       ||...||.....:.....|:.              ||.:|
  Fly   655 AA-AGFHHPSMGHQQDAASEGEPEDDYAHGEHNTTGNSSSMHDDSEPQQMNGHHHHQTHHLDKSD 718

  Fly   308 DISATSPVAADEVKPTAPT----------SSQVAKSAETNLQPDSAASLDVPTTPQDTS 356
            |       :|.|..||..|          ||.|:...:...:|.|... ||||..:|.|
  Fly   719 D-------SAIENSPTTSTTTGGSVGHRHSSPVSTKKKGGAKPQSGGK-DVPTEDKDAS 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42337NP_001246858.1 None
retnNP_788434.1 BRIGHT 294..386 CDD:128777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.