DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42337 and Arid3a

DIOPT Version :9

Sequence 1:NP_001246858.1 Gene:CG42337 / 40335 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001101536.2 Gene:Arid3a / 314616 RGDID:1305299 Length:594 Species:Rattus norvegicus


Alignment Length:321 Identity:63/321 - (19%)
Similarity:99/321 - (30%) Gaps:112/321 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TYGYGYGSSSSASYMPNYYRYAPYASPHYSQHHQGMFTP-------------AGQQIIPSSVLHY 94
            |.|....:|.:::......:|..|..| |....:|:.:|             ..:|....|:..|
  Rat   296 TKGLNLPTSITSAAFTLRTQYMKYLYP-YECERRGLSSPNELQAAIDSNRREGRRQSFGGSLFAY 359

  Fly    95 PPRPHPYQQLPQQQQPHPQQSQPGYEPPPPLPYSSSASYQSRGFGAFAGPTPHYAPPGRSSTP-- 157
            .|           ...|...|.      |.||.:|.....|.. |:...|||.......|:.|  
  Rat   360 SP-----------SGAHSMLSS------PKLPVTSLGLAASTN-GSSITPTPKIKKEEDSAIPIT 406

  Fly   158 APNRTVLPPSY----------------------------LEPLR----SYSAEQQHLS----QQQ 186
            .|.|  ||.|.                            ||.||    |....::.::    :||
  Rat   407 VPGR--LPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESTEPPEKKMALVADEQQ 469

  Fly   187 HLSQQQLQHHPLPGTPKLEDPDVEVEAVA----ESPAQRLT------------------------ 223
            .|.|:.:|...|..|.:| ..::.:.:.|    :.||..||                        
  Rat   470 RLMQRAVQQSFLAMTAQL-PMNIRINSQASESRQDPAVNLTSANGSNSISMSVEMNGIVYTGVLF 533

  Fly   224 ------TSPPM-----ISATGTDSGISNCSTRARSDSSQSTPVYSGEYPVNMSVESASCVP 273
                  |.||.     :|:.||::.:.|.:..:.|..|......:|.....||..|.:.:|
  Rat   534 AQPPPPTPPPASSKGGVSSIGTNNTMGNRTGASGSAGSSGQVGLAGVSAPTMSSTSNNSLP 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42337NP_001246858.1 None
Arid3aNP_001101536.2 ARID_ARID3A 217..349 CDD:350642 9/53 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.