DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42337 and Arid5a

DIOPT Version :9

Sequence 1:NP_001246858.1 Gene:CG42337 / 40335 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001277655.1 Gene:Arid5a / 214855 MGIID:2443039 Length:619 Species:Mus musculus


Alignment Length:266 Identity:51/266 - (19%)
Similarity:93/266 - (34%) Gaps:72/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YHTYGYGYGSSSSASYMPNYYR--YAPYASPHYSQHHQGMFTPAGQQIIPSSVLHYPPRPHPYQQ 103
            |...|...||:|:|:....:|.  ..||.     :|.:|    ...:.:|      |.:|....:
Mouse   139 YDELGGSPGSTSAATCTRRHYERLVLPYV-----RHLKG----EDDKPLP------PTKPRKQYK 188

  Fly   104 LPQQ-----------------QQPHPQQSQPGYEP-----PPPLPYSSSASYQSRGFGAFAGPTP 146
            :.::                 ::...:|:.||...     ...||...|:...:...|..:||:|
Mouse   189 MAKELRGDDGTTEKLKKAKDSEERRVEQTTPGKTKSDATGQTQLPCQGSSRDSTEQLGPVSGPSP 253

  Fly   147 HYAPPGRSSTPAPNRTVLPPSY-------LEPLRSYSAEQQHLSQQQHLSQQQLQ-----HHPLP 199
            ...  |.||.|...:.:|...|       :.||    |:::.|:|.......|.|     |....
Mouse   254 PLT--GASSCPEAYKRLLSSFYCKGAHGIMSPL----AKKKLLAQVSKAEALQCQEEGCRHGARS 312

  Fly   200 GTPKLEDPDVEVEAVAESPAQRLTTSPPMISATGT---DSGISNCSTRARSDSSQSTPVYSG--- 258
            ....::|....:...||:...:||....:.:..|:   ::.:..|.|         .|::||   
Mouse   313 PNKDIQDSPQNLRGPAENSEHQLTPREGLQAPGGSTRMEAQVGPCPT---------APMFSGCFH 368

  Fly   259 EYPVNM 264
            .||..:
Mouse   369 AYPTEV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42337NP_001246858.1 None
Arid5aNP_001277655.1 ARID_ARID5A 85..167 CDD:350648 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.