DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42337 and cfi-1

DIOPT Version :9

Sequence 1:NP_001246858.1 Gene:CG42337 / 40335 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_492644.2 Gene:cfi-1 / 188793 WormBaseID:WBGene00000476 Length:467 Species:Caenorhabditis elegans


Alignment Length:218 Identity:40/218 - (18%)
Similarity:73/218 - (33%) Gaps:59/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LPPSYLEPLRSYSAEQQHLSQQQHLSQQQLQHHPLPGTPKLEDPDVEVEAVAESPAQRLTTSPPM 228
            |...|.:.|..|..|::.||.|..|.|      .:.|..:            |:|.:|...|.|:
 Worm   257 LRTQYQKYLYDYECEKEKLSNQSDLQQ------AIDGNRR------------EAPGRRTAPSFPL 303

  Fly   229 ---------ISATGTDSGISNCSTR--ARSDSSQSTPVYSGEYPVNMSVESASCVPYHCPADARD 282
                     .:||..::.::....|  ...|.:..:...||.:..:...|..:.:      :|..
 Worm   304 PFQLPHAASAAATMLNNQLNGLGMRNDLLDDENTLSLQASGLFGTSYGAEQMAIL------EAHQ 362

  Fly   283 YEEEEHQPPVTAEVRRADTPLDIT----------------------DDISATSPVAADEVKPTAP 325
            ...|..|..|..:|.|..  |.:|                      .||.|..|...::||....
 Worm   363 RNLERAQRAVQQQVARQS--LGLTACSNGNGGNIHNSGRESTSSNDSDIPAKRPKLENDVKTNGA 425

  Fly   326 TSSQVAKSAETNLQPDSAASLDV 348
            :|.:::.....|.:...:.|:::
 Worm   426 SSMRISTKHSDNSKTSMSVSMEI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42337NP_001246858.1 None
cfi-1NP_492644.2 ARID 183..269 CDD:198082 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.