DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42337 and ARID3C

DIOPT Version :9

Sequence 1:NP_001246858.1 Gene:CG42337 / 40335 FlyBaseID:FBgn0259239 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001017363.1 Gene:ARID3C / 138715 HGNCID:21209 Length:412 Species:Homo sapiens


Alignment Length:341 Identity:64/341 - (18%)
Similarity:109/341 - (31%) Gaps:102/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ASYQSRGFGAFAGPTPHYAPPGRSSTPAP-NRTVLPPSYLEPLRSYSAEQQHLSQQQHLSQQQLQ 194
            |:..::|.|..|...| ..||   ..|.| :||:..|.  ..|.:..||::..:::..       
Human     9 AARLAQGVGPLAPACP-LLPP---QPPLPDHRTLQAPE--GALGNVGAEEEEDAEEDE------- 60

  Fly   195 HHPLPGTPKLEDPDVEVEAVAES-PAQRLTTSPPMISATGTDSGISNCSTRARSDSSQSTPVYSG 258
                   .|.|:...|.||..|| |..:..:||                      |||.    .|
Human    61 -------EKREEAGAEEEAAEESRPGAQGPSSP----------------------SSQP----PG 92

  Fly   259 EYPVNMSVESASCVPYHCPADARDYEEEEHQPPVTAEVRRADTPLDITDDISATSPVAADEVKP- 322
            .:|...:.|......|...||.:   .:|....:.:.:::..||::       ..|:.|.:|.. 
Human    93 LHPHEWTYEEQFKQLYELDADPK---RKEFLDDLFSFMQKRGTPVN-------RVPIMAKQVLDL 147

  Fly   323 -----TAPTSSQVAKSAETNLQPDSAASLDVPTT-----------------PQD------TSGDP 359
                 .......:.:.....:..:....|.:|||                 |.:      :|...
Human   148 YALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECETRALSSPGE 212

  Fly   360 ITEAADERPEHARQQQHPVTNNWSPTTRRPR-----------TPPAPQNSP-IGFGQNASVPPAL 412
            :..|.|......|:|.:..|..:......||           .|||.|:|| ...|..:.:|   
Human   213 LQAAIDSNRREGRRQAYTATPLFGLAGPPPRGAQDPALGPGPAPPATQSSPGPAQGSTSGLP--- 274

  Fly   413 AHLLQQQQQQQLQLQQ 428
            ||...|.....::.::
Human   275 AHACAQLSPSPIKKEE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42337NP_001246858.1 None
ARID3CNP_001017363.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 29/132 (22%)
ARID 101..227 CDD:355778 19/135 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..278 13/48 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.