DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and si:dkey-37g12.1

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:XP_021333677.1 Gene:si:dkey-37g12.1 / 796669 ZFINID:ZDB-GENE-090312-145 Length:882 Species:Danio rerio


Alignment Length:238 Identity:74/238 - (31%)
Similarity:120/238 - (50%) Gaps:42/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 EHKKESEKELQRTQKLLDSILPNIVNNQ------IRSEMYKGTDPTVETQFNKLYVYPMDNVSIL 577
            |...|.::|.:|.:.||..:||..|.:|      :|:|.|                   |.|:|.
Zfish   659 ERTAELQEEKKRAEGLLTQMLPRSVASQLIAGKTVRAETY-------------------DCVTIY 704

  Fly   578 FADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDNWKTRPD 642
            |:||:|||.:::..:..|:|.:||||:..||.|.:.::..:|:.:||.|..||.....|   ..|
Zfish   705 FSDIEGFTAMSASLTPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRN---GDD 766

  Fly   643 HAVCSVETGLHMIKAIKDVRLHT-HV---DLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIAN 703
            ||.......|.:::.::.  .|: ||   .|.:|||:|||..:.||:|.|...:.::.:.|..|:
Zfish   767 HAKEIARMSLAIVQGLRS--FHSPHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTAS 829

  Fly   704 HMESGGIPGRVHISEATLKCLNDAYEVEPGNGGCR---DNHLK 743
            .|||.|:|.::|:|.:| |.|.|.:.    |..|.   |.|:|
Zfish   830 RMESYGLPLKIHVSSST-KSLLDTFR----NFRCELRGDIHIK 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 11/37 (30%)
CYCc 526..729 CDD:214485 67/212 (32%)
Guanylate_cyc 566..753 CDD:278633 61/185 (33%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
si:dkey-37g12.1XP_021333677.1 Periplasmic_Binding_Protein_Type_1 <59..258 CDD:324556
PKc_like 355..628 CDD:328722
HNOBA <641..687 CDD:311573 9/27 (33%)
CYCc 666..850 CDD:214485 65/208 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.