DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and Gucy1a2

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_076446.1 Gene:Gucy1a2 / 66012 RGDID:621655 Length:730 Species:Rattus norvegicus


Alignment Length:269 Identity:79/269 - (29%)
Similarity:127/269 - (47%) Gaps:59/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 ETHKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNVSIL 577
            :||:|:|.:|      ::|..||.||.|..|..|:             .|..::.....|:|::|
  Rat   476 KTHQALEEEK------KKTVDLLYSIFPGDVAQQL-------------WQRQQVQARKFDDVTML 521

  Fly   578 FADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDNWKTRPD 642
            |:||.|||.:.::.:..|::.:||:|:.|||.........:|:.:||. |||:            
  Rat   522 FSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDA-YCVA------------ 573

  Fly   643 HAVCSVETGLH----------MIKAIKDVRLHTHV------DLNMRIGIHSGSVMCGVLGNKKWH 691
                   :|||          .:.|:|.:.|...|      .:.||||||||||:.||:|.:...
  Rat   574 -------SGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPR 631

  Fly   692 FDVWSNDVIIANHMESGGIPGRVHISEATLKCL--NDAYEVEP-GNGGCRDNHLKMLNVKTYLIK 753
            :.::.|:|.:|:..|||..|.|::||..|.:.|  .|::...| ......||..|.:....|.::
  Rat   632 YCLFGNNVTLASKFESGSHPRRINISPTTYQLLKREDSFTFIPRSREELPDNFPKEIPGVCYFLE 696

  Fly   754 -RTEPLRPK 761
             ||.|..||
  Rat   697 LRTGPKPPK 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 13/37 (35%)
CYCc 526..729 CDD:214485 64/220 (29%)
Guanylate_cyc 566..753 CDD:278633 60/205 (29%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
Gucy1a2NP_076446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
HNOB <157..268 CDD:285002
HNOBA 314..501 CDD:285003 11/30 (37%)
CYCc 483..672 CDD:214485 65/227 (29%)
Guanylate_cyc 512..696 CDD:278633 60/203 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.