DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and Gucy1b1

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_059497.1 Gene:Gucy1b1 / 54195 MGIID:1860604 Length:620 Species:Mus musculus


Alignment Length:261 Identity:74/261 - (28%)
Similarity:130/261 - (49%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1329 EVTSRLDFIWKEQAERELTNMKSNRALNDTLIKNILPDHVATYYLSDEHTDELYSKMHNLCGVMF 1393
            ::|..|: |..::.:..|..::..:...|||:.::||..||...   .|...:.:|.::...::|
Mouse   364 KLTQELE-ILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANEL---RHKRPVPAKRYDNVTILF 424

  Fly  1394 ASIPNFQDFYSEDIDNGKACIRI---LNEIICDFDELLEEPRFASVEKIKTVGATYMAAAGLNH- 1454
            :.|..|..|.|:.. :|:..::|   ||::...||.|.:..:...|.|::|||..||..:||.. 
Mouse   425 SGIVGFNAFCSKHA-SGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEP 488

  Fly  1455 --EHLRLRGETSEDSVC----DLVEFAFAMKQKLEEINGDAFNNFQLRVGICSGPLVSGVIGARK 1513
              .|.|        |:|    |::|.|..:     :::|:   :.|:.:||.:|.:|:||||.|.
Mouse   489 CIHHAR--------SICHLALDMMEIAGQV-----QVDGE---SVQITIGIHTGEVVTGVIGQRM 537

  Fly  1514 PVYDIWGNTVNVASRMDSTGENWRVQVPENTAELLCSRGYTCV-------------KRGEIAVKG 1565
            |.|.::|||||:.||.::|||..::.|.|.|        |.|:             .||.:::||
Mouse   538 PRYCLFGNTVNLTSRTETTGEKGKINVSEYT--------YRCLMSPENSDPLFHLEHRGPVSMKG 594

  Fly  1566 K 1566
            |
Mouse   595 K 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 63/210 (30%)
Guanylate_cyc 1381..1576 CDD:278633 62/209 (30%)
Gucy1b1NP_059497.1 HNOB 2..166 CDD:311572
HNOBA 207..406 CDD:311573 11/42 (26%)
Guanylate_cyc 412..605 CDD:306677 62/209 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.