DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and NPR2

DIOPT Version :10

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_001365852.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1050 Species:Homo sapiens


Alignment Length:229 Identity:69/229 - (30%)
Similarity:119/229 - (51%) Gaps:27/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 QRLAFIETHKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPM 571
            ::|....|...:|.|:::|       .||..|||:.|..|::    :|  .||:.:       ..
Human   816 EKLVEERTQAYLEEKRKAE-------ALLYQILPHSVAEQLK----RG--ETVQAE-------AF 860

  Fly   572 DNVSILFADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDN 636
            |:|:|.|:||.|||.|:::::..|:|.:||||:..||.|.::....:|:.:||.|..||.....|
Human   861 DSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRN 925

  Fly   637 WKTRPDHAVCSVETGLHMIKAIKDVRL--HTHVDLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDV 699
            .:.   ||.......|.::.|:...|:  ..|..|.:|||:|:|.|..||:|.|...:.::.:.|
Human   926 GQR---HAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTV 987

  Fly   700 IIANHMESGGIPGRVHISEATLKCLND--AYEVE 731
            ..|:.|||.|...::|:|..|...|::  .:::|
Human   988 NTASRMESNGQALKIHVSSTTKDALDELGCFQLE 1021

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <216..551 CDD:318454 12/43 (28%)
Guanylate_cyc 566..753 CDD:425528 54/170 (32%)
Adcy_cons_dom 929..1021 CDD:461877
Guanylate_cyc 1381..1576 CDD:425528
NPR2NP_001365852.1 PBP1_NPR_B 26..421 CDD:380607
PK_GC-A_B 521..795 CDD:270944
HNOBA <801..849 CDD:462234 11/39 (28%)
CYCc 828..1012 CDD:214485 65/206 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.