DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and CG14877

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:289 Identity:51/289 - (17%)
Similarity:98/289 - (33%) Gaps:107/289 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1323 YHARLVEVTSRLDFIWKEQAERELTNMKSNRALNDTLIKNILPDHVATYYLS-DEHTDELYSKMH 1386
            |.|.|..|...|     :.||:::.:            |:::|.|:...:|: |...|.....:.
  Fly    54 YQASLPRVLPIL-----KVAEQQIRS------------KSLIPSHIDFEWLAHDTKCDASLGVIK 101

  Fly  1387 NLCGVMFASIPNFQDFYSEDIDNGKACIRILNEIICDFDELLEEPRFASVEKI----KTVGATYM 1447
            .:.|::                  |.|.:::...:||:.       .|:|.:|    .:.|...:
  Fly   102 AMDGII------------------KQCAQVIFGPVCDYS-------LAAVSRITKYFNSQGTPLI 141

  Fly  1448 AAAGLNHEHLRLRGETSEDSVCDLVEFAFAMKQKLEEINGDAFNNFQLRVGICSGPLVSGVIGAR 1512
            :..|..::                      .:||..:.|.:.:  ..||.|:.|...:|.:    
  Fly   142 SVGGSTYD----------------------FEQKKTDCNDEFY--MLLRTGMLSFETISEL---- 178

  Fly  1513 KPVYDIWGNTVNVASRMDSTGENWRVQVPENTAELLCSRGYTCVKRGEIAVKGKGMMTTFYVHPK 1577
                     |:||..|     .||...:            :...:.|:.:|.|   |.|.::..|
  Fly   179 ---------TINVMKR-----HNWSHSI------------FYYERDGQRSVAG---MHTCFLMMK 214

  Fly  1578 GISESQLISPVRMPAGIPLAQTPNLQRQT 1606
            .:.: |:.:.....|..||  .|||..:|
  Fly   215 SLGK-QMRNENMTFAQFPL--EPNLTNRT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 30/205 (15%)
Guanylate_cyc 1381..1576 CDD:278633 29/198 (15%)
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 51/289 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.