DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and CG31183

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:382 Identity:99/382 - (25%)
Similarity:172/382 - (45%) Gaps:66/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1339 KEQAERELTNMKSNRALNDTLIKNILPDHVATYYLSDEHTDELYSKMHNLCGVMFASIPNFQDFY 1403
            :|..|....:....:...:.|:..:||..||...:|.:   .:.::..:...:.|:.|..|....
  Fly   905 EELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQ---PVVAETFDQVTIYFSDIVGFTAIS 966

  Fly  1404 SEDIDNGKACIRILNEIICDFDELLEEPRFASVEKIKTVGATYMAAAGL----NHEHLRLRGETS 1464
            :|  ......::.||::...||.::|.   ..|.|::|:|..||..:||    .::|.|      
  Fly   967 AE--STPMQVVQFLNDLYTCFDSIVEN---FDVYKVETIGDAYMVVSGLPIRNGNQHAR------ 1020

  Fly  1465 EDSVCDLVEFAFAMKQKLEEINGDAFNNF----------QLRVGICSGPLVSGVIGARKPVYDIW 1519
                 ::...|.|:.        :|.:||          :||:|:.:|..|:||:|.:.|.|.::
  Fly  1021 -----EIARLALALL--------EAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLF 1072

  Fly  1520 GNTVNVASRMDSTGENWRVQVPENTAELLCSRG-YTCVKRGEIAVKGKGMMTTFYVHPKGISESQ 1583
            |:|||.||||:|.||..::.:.|.|.|.|...| :...:||.:.:||||.|.|:::..:....:.
  Fly  1073 GDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGEVPRPNS 1137

  Fly  1584 LISPVRMPAGIPLAQTPNL---QRQTSH--HGSFSAVVFGMLQASKRSTAIAGTPTGTP---SPQ 1640
            ||||.:    :.|.:..:|   ||..||  |..:|.:|...........|||..|..:|   ||.
  Fly  1138 LISPSK----LMLTRRSSLKQPQRSQSHNLHKQYSELVVASPPPQLPPPAIALPPPPSPSKDSPN 1198

  Fly  1641 IRRGHRGSTFSSVRLS------QKS-----TTVNPVRRNTTRVRGRSYRQKKSSSNN 1686
            :|...:.|: ||.:|:      .|:     .|....:||......||.|..:.:|::
  Fly  1199 LRVKRKISS-SSPKLNGGGFDYHKTENHYLDTAAAAQRNCDIYSSRSLRDMEETSDS 1254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 56/215 (26%)
Guanylate_cyc 1381..1576 CDD:278633 58/209 (28%)
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 7/32 (22%)
CYCc 917..1108 CDD:214485 56/217 (26%)
Guanylate_cyc 944..1130 CDD:278633 58/209 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.