DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and Phlpp

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:568 Identity:107/568 - (18%)
Similarity:187/568 - (32%) Gaps:191/568 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1212 TTNGHSVSLS----NLSYSDASVMQSSSDVEGQCAHPEYLVFTWVLCLVSL------------AT 1260
            |||.|.|.|.    ::|:::.|.:.:                 ||....||            ..
  Fly   126 TTNTHPVPLKLQRIDISHNNFSELPN-----------------WVGACASLTAINASHNRLNNVA 173

  Fly  1261 ALKLYYLVKALMALAMVAFYTTLIMM-KFGSG-DSFSLVELSRLGMPLGVQMLILLISFLVMVCY 1323
            .|...|.:..|::|.:.  |..|..: :|..| .|...::|....:|      .|..:|..:.  
  Fly   174 VLLRNYRITELVSLDLA--YNDLKQLDQFPEGFSSIRSLQLQSNELP------SLPDNFFAVT-- 228

  Fly  1324 HARLVEVTSRLDFIWKEQAERELTNMKSNRALNDTLIKNILPDHVATYYLS---DEHTDELYSKM 1385
            ||||                 |..|:..|:.  .||.:....:|.|...||   :...|.::..:
  Fly   229 HARL-----------------ETLNVSCNKL--STLPRYEQNNHAALVNLSLAGNHLNDSIFEPL 274

  Fly  1386 HN--------------------------------LCGVMFASIPNFQDFYSEDIDNGKACIRILN 1418
            ||                                |.|.|...:|       |::    |.:..|.
  Fly   275 HNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLP-------EEV----ATLGQLR 328

  Fly  1419 EIICDFDELLEEPRFASVEKIKTVGATYMAAAGLNHEHLRLRGETSEDSVCDLVEFAFAMKQKLE 1483
            .:.|..:.||..|:.|.:..:|.:        .|:|.||        |.| :|:....:...|..
  Fly   329 VLRCCNNLLLCTPQLAKLAMLKVL--------DLSHNHL--------DRV-NLLALVPSRNLKYL 376

  Fly  1484 EINGDAFNNFQLRVG-----ICSGPLVSGVIGARKPVYDIWGNTVNVASRMDSTGENWRVQVPEN 1543
            :::|    |.||:|.     :|...      ..|.     |       |.:|.:|.| |..:|..
  Fly   377 DLSG----NLQLQVDEQQFKVCQSQ------SQRH-----W-------SLVDVSGNN-RAALPTT 418

  Fly  1544 TAELLCSRGYTCVKRGEIAVKGKGMMTTFYVHPKGISESQLISPVRMPAGIPLAQTPNLQRQTSH 1608
            ....:.:      :|.:  .|..|..|..:....|..:.:.:|..::.|              ::
  Fly   419 KIRQVSA------QRNQ--NKTSGPWTMGFAETPGSGDCRKLSVYQLRA--------------AN 461

  Fly  1609 HGSFSAVVFGMLQASKRSTAIAGTPTGTPSPQIRRGHRGSTFSSVRLSQKSTTV------NPVRR 1667
            :|.....::||.:|.: ....|........|.:.:..:....|:||...|.|.:      ..||.
  Fly   462 YGGSDEALYGMFEALE-GRGRAAQEMSHLVPDLMKQEQMVKDSAVRDYMKFTLLAAQQQCGSVRS 525

  Fly  1668 ----NTTRVRGRSYRQKKSSSNNSIVTQASSSYMPSF--RRIDQIETT 1709
                :.||.|..| :.:...|...::..||:..:.::  ||..|:..|
  Fly   526 AALFHLTRTRAPS-KVRPLKSKRYVLRMASTGGLDAYLIRRTSQLRLT 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 44/240 (18%)
Guanylate_cyc 1381..1576 CDD:278633 41/231 (18%)
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 12/59 (20%)
leucine-rich repeat 111..135 CDD:275380 5/8 (63%)
leucine-rich repeat 136..158 CDD:275380 4/38 (11%)
leucine-rich repeat 159..183 CDD:275380 3/23 (13%)
leucine-rich repeat 184..209 CDD:275380 7/26 (27%)
LRR_8 205..266 CDD:290566 18/87 (21%)
leucine-rich repeat 210..230 CDD:275380 4/27 (15%)
leucine-rich repeat 232..255 CDD:275380 7/41 (17%)
LRR_RI <256..410 CDD:238064 36/203 (18%)
leucine-rich repeat 256..276 CDD:275380 3/19 (16%)
LRR_8 279..359 CDD:290566 15/98 (15%)
leucine-rich repeat 280..303 CDD:275380 0/22 (0%)
leucine-rich repeat 304..348 CDD:275380 12/54 (22%)
leucine-rich repeat 349..372 CDD:275380 8/39 (21%)
PP2Cc 461..655 CDD:294085 24/114 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.