DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and Gyc32E

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster


Alignment Length:332 Identity:95/332 - (28%)
Similarity:151/332 - (45%) Gaps:66/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 LQHGEATINPECVLFQIFANFILYT---AINVAGMYTKYLTDRGQRLAFIETHKAMEHKKESEKE 527
            |:..:|.:.|     .||.|.:...   |.|:.|:..:            .|:...|.||     
  Fly   826 LKELQAGLKP-----NIFDNMLSIMEKYAYNLEGLVQE------------RTNLLYEEKK----- 868

  Fly   528 LQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNVSILFADIKGFTELASKTS 592
              :|..||..:||..|     :|:.|..|| ||.:.       .|.|:|||:||.|||||.:.::
  Fly   869 --KTDMLLYQMLPRPV-----AELLKRGDP-VEAEC-------FDCVTILFSDIVGFTELCTTST 918

  Fly   593 AQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDNWKTRPDHAVCSVETGLHMIKA 657
            ..::|::|||.:...|.|..:....:|:.:||.|..||.....|...   ||.......||:::.
  Fly   919 PFEVVEMLNDWYTCCDSIISNYDVYKVETIGDAYMVVSGLPLQNGSR---HAGEIASLALHLLET 980

  Fly   658 IKDVRL-HTHVD-LNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIANHMESGGIPGRVHISEAT 720
            :.:::: |...: :.:|||:|||....||:|.|...:.::.:.|..|:.|||.|...|:||||||
  Fly   981 VGNLKIRHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSMRIHISEAT 1045

  Fly   721 LKCLNDAYEVEPGNGGCRDNHLKML----NVKTY-LIKRTEP-LRPKRRFGTRSSAHLAGSVATA 779
            .:.|...     |:..|.:..|..:    :::|| |.||.:| |.|          .|..:|.|.
  Fly  1046 YQLLQVI-----GSYVCIERGLTSIKGKGDMRTYWLTKRQQPELTP----------DLISTVDTL 1095

  Fly   780 APPCATP 786
            ...|:.|
  Fly  1096 DTYCSGP 1102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 19/87 (22%)
CYCc 526..729 CDD:214485 66/204 (32%)
Guanylate_cyc 566..753 CDD:278633 60/193 (31%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365
ANF_receptor 59..427 CDD:279440
PHA02988 534..826 CDD:165291 95/332 (29%)
PK_GC-A_B 550..832 CDD:270944 1/5 (20%)
HNOBA <847..886 CDD:285003 14/62 (23%)
CYCc 865..1057 CDD:214485 70/219 (32%)
Guanylate_cyc 892..1076 CDD:278633 61/198 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.