DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and GUCY2C

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_004954.2 Gene:GUCY2C / 2984 HGNCID:4688 Length:1073 Species:Homo sapiens


Alignment Length:396 Identity:96/396 - (24%)
Similarity:157/396 - (39%) Gaps:120/396 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1338 WKEQAERE---------------LTNMKSNRALNDTLIK----------NILPDHVATYYLSDEH 1377
            |:|..|:.               |.:.:.|.:..||||:          :::.:....|....:.
Human   728 WEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDR 792

  Fly  1378 TD-----------------------ELYSKMHNLCGVMFASIPNFQDF--YSEDIDNGKACIRIL 1417
            .|                       |||.::    .:.|:.|..|...  ||..::    .:.:|
Human   793 ADRLNFMLLPRLVVKSLKEKGFVEPELYEEV----TIYFSDIVGFTTICKYSTPME----VVDML 849

  Fly  1418 NEIICDFDELLEEPRFASVEKIKTVGATYMAAAGL----NHEHLRLRGETSEDSVCDLVEFA--- 1475
            |:|...||.:::.   ..|.|::|:|..||.|:||    .:.|           ..|:.:.|   
Human   850 NDIYKSFDHIVDH---HDVYKVETIGDAYMVASGLPKRNGNRH-----------AIDIAKMALEI 900

  Fly  1476 --FAMKQKLEEINGDAFNNFQLRVGICSGPLVSGVIGARKPVYDIWGNTVNVASRMDSTGENWRV 1538
              |....:||.:.|   ....:|:|:.|||..:||:|.:.|.|.::|:|||.||||:|||...|:
Human   901 LSFMGTFELEHLPG---LPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRI 962

  Fly  1539 QVPENTAELL----CSRGYTCVKRGEIAVKGKGMMTTFYVHPKGISESQLISPVRMPAGIPLAQT 1599
            .|..:|..:|    |...|..  |||..:||:|..||:::  .|:.:.:...|.          .
Human   963 HVSGSTIAILKRTECQFLYEV--RGETYLKGRGNETTYWL--TGMKDQKFNLPT----------P 1013

  Fly  1600 PNLQRQTSHHGSFSAVVFGMLQASKRSTAIAGTPTGTPSPQIRRGHRGSTFSSVRLSQKSTTVNP 1664
            |.::.|......||.::...||  ||..|      |..|.:.||          ..|.|..|:..
Human  1014 PTVENQQRLQAEFSDMIANSLQ--KRQAA------GIRSQKPRR----------VASYKKGTLEY 1060

  Fly  1665 VRRNTT 1670
            ::.|||
Human  1061 LQLNTT 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 61/248 (25%)
Guanylate_cyc 1381..1576 CDD:278633 63/209 (30%)
GUCY2CNP_004954.2 PBP1_GC_C_enterotoxin_receptor 35..415 CDD:107364
PK_GC-C 480..750 CDD:270946 3/21 (14%)
Pkinase_Tyr 502..745 CDD:285015 3/16 (19%)
CYCc 788..979 CDD:214485 56/215 (26%)
Guanylate_cyc 815..1002 CDD:278633 64/215 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.