DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and GUCY1A2

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens


Alignment Length:299 Identity:79/299 - (26%)
Similarity:129/299 - (43%) Gaps:90/299 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 THKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNVSILF 578
            ||:|:|.:|      ::|..||.||.|    ..:..::::|.    :.|..|     .|:|::||
Human   479 THQALEEEK------KKTVDLLYSIFP----GDVAQQLWQGQ----QVQARK-----FDDVTMLF 524

  Fly   579 ADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDNWKTRPDH 643
            :||.|||.:.::.:..|::.:||:|:.|||.........:|:.:||. |||:             
Human   525 SDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDA-YCVA------------- 575

  Fly   644 AVCSVETGLH----------MIKAIKDVRLHTHV------------------------------- 667
                  .|||          .:.|:|.:.|...|                               
Human   576 ------AGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQPQRSELLFSFPVSIQLVPDQHQ 634

  Fly   668 ---DL---NMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIANHMESGGIPGRVHISEATLKCL-- 724
               ||   .||||||||||:.||:|.:...:.::.|:|.:|:..|||..|.|:::|..|.:.|  
Human   635 SETDLGTEKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKR 699

  Fly   725 NDAYEVEP-GNGGCRDNHLKMLNVKTYLIK-RTEPLRPK 761
            .:::...| ......||..|.:....|.:: ||.|..||
Human   700 EESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPK 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 11/36 (31%)
CYCc 526..729 CDD:214485 64/251 (25%)
Guanylate_cyc 566..753 CDD:278633 60/236 (25%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002
HNOBA 316..503 CDD:285003 11/33 (33%)
CYCc 485..705 CDD:214485 65/258 (25%)
Guanylate_cyc 514..729 CDD:278633 61/239 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.