DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gcy-36

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_510557.3 Gene:gcy-36 / 191657 WormBaseID:WBGene00001556 Length:675 Species:Caenorhabditis elegans


Alignment Length:313 Identity:89/313 - (28%)
Similarity:138/313 - (44%) Gaps:51/313 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1285 MMKFGSGDSF---------SLVELSRLG-----MPL--GVQMLILLISFLVMVCYHARLVEVTSR 1333
            ||...||...         |:.||.:.|     ||:  ..:.||||        ...||.:|...
 Worm   339 MMLMSSGGHIMYLCSPYVTSIPELLQYGLRLTAMPIHDPTRDLILL--------NQQRLSDVEMN 395

  Fly  1334 LDF-IWKEQAERELTNMKSNRALNDTLIKNILPDHVATYY---LSDEHTDELYSKMHNLCGVMFA 1394
            |.. ...||.|....:::..:...|.|::.:||..||...   ||.|      ::.:....|||.
 Worm   396 LQLEANNEQLENMAKDLEVEKGKTDALLREMLPPSVAQQLKQGLSVE------AREYEEATVMFT 454

  Fly  1395 SIPNFQDFYSEDIDNGKACIRILNEIICDFDELLEEPRFASVEKIKTVGATYMAAAGLNHEHLRL 1459
            .:|.||...  .:...|..:.:|||:...||.|:   ......|::|||.:||:..|:       
 Worm   455 DVPTFQQIV--PLCTPKDIVHLLNELFTKFDRLI---GIQKAYKVETVGDSYMSVGGI------- 507

  Fly  1460 RGETSEDSVCDLV-EFAFAMKQKLEEINGDAFNN-FQLRVGICSGPLVSGVIGARKPVYDIWGNT 1522
              ....|..|::: ..|..|..:...:.....|. ..:|.||.|||:|:||:||:.|.|.::|:|
 Worm   508 --PDLVDDHCEVICHLALGMVMEARTVCDPITNTPLHIRAGIHSGPVVAGVVGAKMPRYCLFGDT 570

  Fly  1523 VNVASRMDSTGENWRVQVPENTAELLCSRG-YTCVKRGEIAVKGKGMMTTFYV 1574
            ||.:|||:|.....|:...||..:...|.| :....||.:.:||||.|.|:::
 Worm   571 VNTSSRMESHSPIGRIHCSENAKKCAESTGRFEFEPRGRVQIKGKGEMNTYFL 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 60/206 (29%)
Guanylate_cyc 1381..1576 CDD:278633 59/197 (30%)
gcy-36NP_510557.3 HNOB 3..167 CDD:285002
HNOBA 217..435 CDD:285003 27/103 (26%)
CYCc 415..604 CDD:214485 60/208 (29%)
Guanylate_cyc 441..624 CDD:278633 60/203 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.