DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gcy-23

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_500309.3 Gene:gcy-23 / 191652 WormBaseID:WBGene00001548 Length:1073 Species:Caenorhabditis elegans


Alignment Length:260 Identity:75/260 - (28%)
Similarity:126/260 - (48%) Gaps:47/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1342 AER----ELTNMKSNRALNDTLIKNILPDHVATYYLSDEHTDELY------SKMHNLCGVMFASI 1396
            |||    |..|:::     |.|:..:||.:||         :||.      :|..::..|||:.|
 Worm   834 AERTGMLEEANVRA-----DKLLGQLLPKYVA---------NELKMGRSVPAKTFDMATVMFSDI 884

  Fly  1397 PNFQDFYSEDIDNGKACIRILNEIICDFDELLEEPRFASVEKIKTVGATYMAAAGL----NHEHL 1457
            ..|....|.  ......:.:||.|...||:.:.:   ....|::|:|..||..:|:    .:||:
 Worm   885 VGFTTICSS--STPLEVVSMLNSIYSKFDDAINK---HGSYKVETIGDAYMIVSGIPEENGNEHI 944

  Fly  1458 RLRGETSEDSVCDLVEFAFAMKQKLEEINGDAFNNFQLRVGICSGPLVSGVIGARKPVYDIWGNT 1522
            |        ::|: ......:..|..||........::|:||.:|.:.:||:|...|.|.::|:|
 Worm   945 R--------NICN-TALELMLLLKTYEIPHRRNVKLRIRLGIHTGTVAAGVVGLTAPRYCLFGDT 1000

  Fly  1523 VNVASRMDSTGENWRVQVPENTAELLCSRGYT---CVKRGEIAVKGKGMMTTFYVHPKGISESQL 1584
            |||||||:||.|..::|:.:...: .|.|.|:   ...||.:..||||.:|::::..|. ||||:
 Worm  1001 VNVASRMESTSEPEKIQMSQEARD-FCVRYYSEFQITLRGTVEAKGKGPVTSYWLLGKQ-SESQM 1063

  Fly  1585  1584
             Worm  1064  1063

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 57/210 (27%)
Guanylate_cyc 1381..1576 CDD:278633 58/207 (28%)
gcy-23NP_500309.3 Periplasmic_Binding_Protein_Type_1 38..407 CDD:299141
ANF_receptor 38..385 CDD:279440
PK_GC 509..806 CDD:270894
HNOBA <817..863 CDD:285003 11/42 (26%)
CYCc 842..1035 CDD:214485 59/221 (27%)
Guanylate_cyc 869..1056 CDD:278633 57/201 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.