DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gcy-15

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_001364713.1 Gene:gcy-15 / 191648 WormBaseID:WBGene00001541 Length:1104 Species:Caenorhabditis elegans


Alignment Length:291 Identity:83/291 - (28%)
Similarity:144/291 - (49%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1295 SLVELSRLGMPLGVQMLILLISFLVMVCYHARLVEVTSRLDFIWKEQAERELTNMKSNRALNDTL 1359
            ||.::.|...||.:.:...::..:|     :.:.:.|.:|:   |:.|||. ..:::.:|.::.|
 Worm   811 SLHQIKRKLKPLTIGLKRTIMDNMV-----SMIEKYTDKLE---KDIAERN-EELEAEKAKSEAL 866

  Fly  1360 IKNILPDHVA-TYYLSDEHTDELYSKMHNLCGVMFASIPNFQDF--YSEDIDNGKACIRILNEII 1421
            :|.:||:.|| :..|....:.|.:..    |.|.|:..|.|.:.  .|:.||    .::.||::.
 Worm   867 LKMMLPEVVADSLKLGSNVSAESFEN----CTVFFSDCPGFVEMSATSKPID----IVQFLNDLY 923

  Fly  1422 CDFDELLEEPRFASVEKIKTVGATYMAAAGL-----NHEHLRLRGETSEDSVCDLVEFAFAMKQK 1481
            ..||.::::   ..|.|::|:...||.|:||     ||.    .||        :.....|:.:.
 Worm   924 TVFDRIIDQ---FDVYKVETIADAYMVASGLPVPNGNHH----AGE--------IASLGLALLKA 973

  Fly  1482 LEEINGDAFNN--FQLRVGICSGPLVSGVIGARKPVYDIWGNTVNVASRMDSTGENWRVQVPENT 1544
            :|........|  .:||:|:.|||.|:||:|.:.|.|.::|:|||.||||:|.|...|:......
 Worm   974 VESFKIRHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRINCSGTA 1038

  Fly  1545 AELLCS-RGYTCVKRGEIAVKGKGMMTTFYV 1574
            .|:|.. .||...:||.:.:||||...|::|
 Worm  1039 KEILDQLGGYEIEERGIVEMKGKGKQMTYFV 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 62/211 (29%)
Guanylate_cyc 1381..1576 CDD:278633 62/204 (30%)
gcy-15NP_001364713.1 Periplasmic_Binding_Protein_type1 2..363 CDD:415822
PK_GC 553..822 CDD:270894 3/10 (30%)
HNOBA <831..879 CDD:400168 14/56 (25%)
Guanylate_cyc 885..1071 CDD:306677 63/208 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.