DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gcy-13

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_506097.3 Gene:gcy-13 / 191646 WormBaseID:WBGene00001539 Length:1028 Species:Caenorhabditis elegans


Alignment Length:223 Identity:66/223 - (29%)
Similarity:114/223 - (51%) Gaps:18/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 IETHKAM--EHKKESEKELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNV 574
            :|.|.:.  :..:|..|||...:|..|.:|..::..|:...:..|  .:||.:       ..::|
 Worm   788 LEKHASSLEDEVQERMKELVEEKKKSDILLYRMLPQQVAERLKLG--QSVEPE-------AFESV 843

  Fly   575 SILFADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDNWKT 639
            :|.|:|:.|||.||:|::..|:|.:||||:..||.|.|.|...:|:.:||.|..||.....|   
 Worm   844 TIFFSDVVGFTVLANKSTPLQVVNLLNDLYTTFDAIIEKNDSYKVETIGDAYLVVSGLPRRN--- 905

  Fly   640 RPDHAVCSVETGLHMIKAIKDVRLHTHV---DLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVII 701
            ..:|........|.::.:::..:: .|:   .:.:|||:||||.:.||:|.....:.::.:.|..
 Worm   906 GTEHVANIANMSLELMDSLQAFKI-PHLPQEKVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNT 969

  Fly   702 ANHMESGGIPGRVHISEATLKCLNDAYE 729
            |:.|||.|.||.:|:|......|...|:
 Worm   970 ASRMESNGKPGFIHLSSDCYDLLTSLYK 997

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 10/40 (25%)
CYCc 526..729 CDD:214485 62/205 (30%)
Guanylate_cyc 566..753 CDD:278633 53/167 (32%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
gcy-13NP_506097.3 PBP1_NPR_GC_like 3..397 CDD:107347
ANF_receptor 13..368 CDD:279440
PKc_like 548..770 CDD:304357
HNOBA <797..829 CDD:285003 8/31 (26%)
CYCc 808..1000 CDD:214485 60/203 (30%)
Guanylate_cyc 835..1022 CDD:278633 55/174 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.