DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gcy-20

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_507101.1 Gene:gcy-20 / 184797 WormBaseID:WBGene00001545 Length:1108 Species:Caenorhabditis elegans


Alignment Length:311 Identity:83/311 - (26%)
Similarity:138/311 - (44%) Gaps:43/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 IETH------KAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYP 570
            :||:      :..:..||..:|.:::..||..:||.:|.::::      ...|||.:       .
 Worm   820 LETYASTLEEEVSDRTKELTEEKKKSDVLLYRMLPRMVADKLK------LGQTVEPE-------T 871

  Fly   571 MDNVSILFADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESD 635
            .:.|:|.|:|:..||.||.|.:..|:|.:||||:..||.|.|.|...:|:.:||.|.|||.....
 Worm   872 FEQVTIFFSDVVQFTTLAGKCTPLQVVTLLNDLYTIFDGIIEQNDVYKVETIGDGYLCVSGLPHR 936

  Fly   636 NWKTRPDHAVCSVETGLHMIKAIKDVRL-HTHVD-LNMRIGIHSGSVMCGVLGNKKWHFDVWSND 698
            |..   ||........|..:.:::..|: |...: :|:||||:.|||:.||:|.....:.::.:.
 Worm   937 NGN---DHIRHIARMSLGFLSSLEFFRVQHLPAERINLRIGINCGSVVAGVVGLTMPRYCLFGDA 998

  Fly   699 VIIANHMESGGIPGRVHISEATLKCLNDAYEVEPGNGGCRDNHLKMLNVKTYLIKRTEPLRPKRR 763
            |..|:.|||.|.||::|::....:.|....      ||.|......:.:|...:..|..|     
 Worm   999 VNTASRMESNGKPGQIHVTAEANRMLTQVV------GGFRTESRGEVIIKGKGVMETFWL----- 1052

  Fly   764 FGTRSSAHLAGSVATAAPPCATPTALPKSISASGSGSIGGVTATGNDGASI 814
                    |.......||..|.|..:....|......|....|.|::.:|:
 Worm  1053 --------LGEESGYTAPSKAAPKVIQHRQSIRSISPILEKNAEGSETSSL 1095

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 10/44 (23%)
CYCc 526..729 CDD:214485 63/204 (31%)
Guanylate_cyc 566..753 CDD:278633 58/188 (31%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
gcy-20NP_507101.1 PBP1_NPR_GC_like 22..439 CDD:107347
ANF_receptor 44..418 CDD:279440
PKc_like 536..801 CDD:304357
STYKc 562..801 CDD:214568
HNOBA <818..861 CDD:285003 10/40 (25%)
CYCc 840..1032 CDD:214485 65/213 (31%)
Guanylate_cyc 867..1054 CDD:278633 62/215 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.