DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and Npr1

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_032753.5 Gene:Npr1 / 18160 MGIID:97371 Length:1057 Species:Mus musculus


Alignment Length:248 Identity:75/248 - (30%)
Similarity:121/248 - (48%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 THKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNVSILF 578
            |...:|.|:::|       .||..|||:.|..|::    :|  .||:.:       ..|:|:|.|
Mouse   831 TQAYLEEKRKAE-------ALLYQILPHSVAEQLK----RG--ETVQAE-------AFDSVTIYF 875

  Fly   579 ADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDNWKTRPDH 643
            :||.|||.|:::::..|:|.:||||:..||.:.::....:|:.:||.|..||.....|.:.   |
Mouse   876 SDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQL---H 937

  Fly   644 AVCSVETGLHMIKAIKDVRL--HTHVDLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIANHME 706
            |.......|.::.|::..|:  .....|.:|||||:|.|..||:|.|...:.::.:.|..|:.||
Mouse   938 AREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRME 1002

  Fly   707 SGGIPGRVHISEATLKCLN--DAYEVE-------PGNGGCRDNHLKMLNVKTY 750
            |.|...|:|:|..|...|.  |.:|:|       .|.|          .|:||
Mouse  1003 SNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKG----------KVRTY 1045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 11/36 (31%)
CYCc 526..729 CDD:214485 64/206 (31%)
Guanylate_cyc 566..753 CDD:278633 61/196 (31%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
Npr1NP_032753.5 PBP1_NPR_A 32..439 CDD:107380
ANF_receptor 50..410 CDD:279440
PK_GC-A_B 530..803 CDD:270944
TyrKc 543..797 CDD:197581
HNOBA <812..857 CDD:285003 10/32 (31%)
CYCc 836..1025 CDD:214485 66/211 (31%)
Guanylate_cyc 863..1049 CDD:278633 62/203 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.