DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gcy-22

DIOPT Version :10

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_508018.2 Gene:gcy-22 / 180365 WormBaseID:WBGene00001547 Length:1058 Species:Caenorhabditis elegans


Alignment Length:94 Identity:19/94 - (20%)
Similarity:29/94 - (30%) Gaps:28/94 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SNSARTSHLSFLRSPLPWL---FIFLFFLPLLLISTTGGGGSRKTCRPSSSTYSHLSLVDKANSS 94
            ||.:.|:.:..:.....|:   .|..||..|          .|..|               .|.|
 Worm     9 SNVSTTTSMEKIDHAASWISATVISAFFTSL----------ERCAC---------------VNLS 48

  Fly    95 SSVVPEEEDDDVPPRVPALYPQRPRMFNT 123
            :|...:::|||.....|......|...:|
 Worm    49 TSHDDDDDDDDESHHRPLALSAAPHPNDT 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <216..551 CDD:318454
Guanylate_cyc 566..753 CDD:425528
Adcy_cons_dom 929..1021 CDD:461877
Guanylate_cyc 1381..1576 CDD:425528
gcy-22NP_508018.2 PBP1_NPR_GC-like 27..411 CDD:380575 15/76 (20%)
Protein Kinases, catalytic domain 553..795 CDD:473864
HNOBA <791..852 CDD:462234
CYCc 831..1023 CDD:214485
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.