DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and daf-11

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_505960.3 Gene:daf-11 / 179605 WormBaseID:WBGene00000907 Length:1077 Species:Caenorhabditis elegans


Alignment Length:280 Identity:79/280 - (28%)
Similarity:138/280 - (49%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 IIK-LQHGEATINPECVLFQIFANFILYTAINVAGMYTKYLTDRGQRLAFIETHKAMEHKKESEK 526
            :|| |::...::.|:..|.:...:.:|..:.::..:..|.||...|.|.  ||.|  ....|.||
 Worm   669 LIKMLENCFGSVRPDIALARKIIDTVLKMSGSLVDLMIKNLTAYTQGLN--ETVK--NRTAELEK 729

  Fly   527 ELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNVSILFADIKGFTELASKT 591
            |.::..:||..:||..|.|.:::.:  ..||       |:|    :|.:||::||.|||.|.|::
 Worm   730 EQEKGDQLLMELLPKSVANDLKNGI--AVDP-------KVY----ENATILYSDIVGFTSLCSQS 781

  Fly   592 SAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQ-----FESDNWKTRPDHAVCSVETG 651
            ...::|.:|:.::.|||.|.......:::.:||. |||:.     .|.|:.|     ::|     
 Worm   782 QPMEVVTLLSGMYQRFDLIISQQGGYKMETIGDA-YCVAAGLPVVMEKDHVK-----SIC----- 835

  Fly   652 LHMIKAIKDVRLHTHVD--------LNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIANHMESG 708
              ||..::...|| |.:        ||.|.|.:||.|..||:|.|...:..:...||:|:.|||.
 Worm   836 --MIALLQRDCLH-HFEIPHRPGTFLNCRWGFNSGPVFAGVIGQKAPRYACFGEAVILASKMESS 897

  Fly   709 GIPGRVHISEATLKCLNDAY 728
            |:..|:.::.|:.:.|.:.:
 Worm   898 GVEDRIQMTLASQQLLEENF 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 24/88 (27%)
CYCc 526..729 CDD:214485 63/216 (29%)
Guanylate_cyc 566..753 CDD:278633 52/176 (30%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
daf-11NP_505960.3 Periplasmic_Binding_Protein_Type_1 <33..295 CDD:299141
PKc_like 447..695 CDD:304357 5/25 (20%)
HNOBA <714..750 CDD:285003 15/39 (38%)
CYCc 729..922 CDD:214485 63/216 (29%)
Guanylate_cyc 756..943 CDD:278633 55/187 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.