Sequence 1: | NP_001262138.1 | Gene: | Ac78C / 40333 | FlyBaseID: | FBgn0024150 | Length: | 1727 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502449.2 | Gene: | gcy-18 / 178237 | WormBaseID: | WBGene00001543 | Length: | 1113 | Species: | Caenorhabditis elegans |
Alignment Length: | 222 | Identity: | 66/222 - (29%) |
---|---|---|---|
Similarity: | 109/222 - (49%) | Gaps: | 30/222 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 530 RTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNVSILFADIKGFTELASKTSAQ 594
Fly 595 QLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDNWKTRPDHAVCSVETGLHMIKAIK 659
Fly 660 DVRL-H--THVDLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIANHMESGGIPGRVHISEAT- 720
Fly 721 --LKCLNDAY------EVE-PGNGGCR 738 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ac78C | NP_001262138.1 | AC_N | <288..551 | CDD:292831 | 7/20 (35%) |
CYCc | 526..729 | CDD:214485 | 60/210 (29%) | ||
Guanylate_cyc | 566..753 | CDD:278633 | 56/186 (30%) | ||
DUF1053 | 929..1020 | CDD:283888 | |||
CYCc | 1353..1554 | CDD:214485 | |||
Guanylate_cyc | 1381..1576 | CDD:278633 | |||
gcy-18 | NP_502449.2 | Periplasmic_Binding_Protein_Type_1 | 87..448 | CDD:299141 | |
ANF_receptor | 87..395 | CDD:279440 | |||
PKc_like | 549..846 | CDD:304357 | |||
HNOBA | <857..903 | CDD:285003 | 7/16 (44%) | ||
CYCc | 882..1073 | CDD:214485 | 60/203 (30%) | ||
Guanylate_cyc | 909..1095 | CDD:278633 | 58/197 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |