DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gcy-18

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_502449.2 Gene:gcy-18 / 178237 WormBaseID:WBGene00001543 Length:1113 Species:Caenorhabditis elegans


Alignment Length:222 Identity:66/222 - (29%)
Similarity:109/222 - (49%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 RTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNVSILFADIKGFTELASKTSAQ 594
            |..:||..:||..|.|:::  |.:...|       |||    .:.:|||:||.|||.:.|.::..
 Worm   886 RADQLLTQLLPAYVANELK--MGRSVAP-------KLY----SSATILFSDIVGFTTICSGSTPL 937

  Fly   595 QLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDNWKTRPDHAVCSVETGLHMIKAIK 659
            ::|.:||.|:..||.....|...:|:.:||.|..||....:|   ..:|:.....|.|.|.:.:.
 Worm   938 EVVNMLNGLYTGFDECITRNKSYKVETIGDAYMVVSGIPEEN---EYNHSRNIANTALDMRQYLT 999

  Fly   660 DVRL-H--THVDLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIANHMESGGIPGRVHISEAT- 720
            ..:: |  || .:..|.|.|:|||..||:|.....:.::.:.|.:::.|||.|.||.:.:||.. 
 Worm  1000 GYQIPHRPTH-RVRCRWGFHTGSVAAGVVGLTCPRYCLFGDTVNVSSRMESTGTPGMIQMSEEAH 1063

  Fly   721 --LKCLNDAY------EVE-PGNGGCR 738
              ::..:..:      ||: .|.|.||
 Worm  1064 MHIRAHHPVFTTTERGEVQVKGKGTCR 1090

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 7/20 (35%)
CYCc 526..729 CDD:214485 60/210 (29%)
Guanylate_cyc 566..753 CDD:278633 56/186 (30%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
gcy-18NP_502449.2 Periplasmic_Binding_Protein_Type_1 87..448 CDD:299141
ANF_receptor 87..395 CDD:279440
PKc_like 549..846 CDD:304357
HNOBA <857..903 CDD:285003 7/16 (44%)
CYCc 882..1073 CDD:214485 60/203 (30%)
Guanylate_cyc 909..1095 CDD:278633 58/197 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.