DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gcy-8

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_501324.2 Gene:gcy-8 / 177584 WormBaseID:WBGene00001535 Length:1152 Species:Caenorhabditis elegans


Alignment Length:353 Identity:91/353 - (25%)
Similarity:146/353 - (41%) Gaps:79/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1273 ALAMVAFYTTLIMMKFGSGDSFS-LVELSRLG-------MPLGVQMLILLISFLVMVCYH----- 1324
            |..:|.:......:.|..|.:.| |||..|.|       :|.. ::|.:.:|.|:..|::     
 Worm   779 AFGLVMYEIIFRALPFPEGTNQSELVEWLRDGSKVVKPTIPQN-KVLNMDLSALIQDCWNTTPEM 842

  Fly  1325 ------------------ARLVEVTSRLDFIWKEQAER---ELTNM---KSNRALNDTLIKNILP 1365
                              ..||:..:|:...:....|:   |.|.|   .:.||  |.|:..:||
 Worm   843 RPSLRRIKLNVETYLNIKGSLVDQMTRMMEQYANNLEKLVAERTGMLEEANQRA--DRLLSQLLP 905

  Fly  1366 DHVATYYLSDEHTDELY------SKMHNLCGVMFASIPNFQDFYSEDIDNGK--ACIRILNEIIC 1422
            .:||         :||.      .|......|:|:.|..|    :|...|..  ..:.:||.|..
 Worm   906 AYVA---------NELKLGRPVPPKTFTSSTVLFSDIVGF----TEMCQNASPLEVVAVLNGIFD 957

  Fly  1423 DFDELLEEPRFASVEKIKTVGATYMAAAGL----NHEHLRLRGETSEDSVCDLVEFAFAMKQKLE 1483
            .||:.:..   ....|::|:|..||..:|:    .|.|:......:.|....|.||....|:.  
 Worm   958 GFDQFIAR---KDAYKVETIGDAYMVVSGVPEENGHRHINEIASIALDVHKFLSEFIVPHKRD-- 1017

  Fly  1484 EINGDAFNNFQLRVGICSGPLVSGVIGARKPVYDIWGNTVNVASRMDSTGENWRVQVPENTAELL 1548
                   ...|.|:|..:||:.:.|:|...|.|.::|:|||:||||:|..|..:.|:.|....||
 Worm  1018 -------TKVQCRLGFHTGPVAAAVVGLNAPRYCLFGDTVNMASRMESNSEPGKTQISETAKNLL 1075

  Fly  1549 CSR--GYTCVKRGEIAVKGKGMMTTFYV 1574
            ...  .|.|.:||||.:||||:..|:::
 Worm  1076 LKEYPDYICEQRGEIPIKGKGLCMTYWL 1103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 58/214 (27%)
Guanylate_cyc 1381..1576 CDD:278633 60/208 (29%)
gcy-8NP_501324.2 ANF_receptor 87..442 CDD:279440
Periplasmic_Binding_Protein_Type_1 94..434 CDD:299141
PKc_like 558..850 CDD:304357 15/71 (21%)
HNOBA <866..912 CDD:285003 13/56 (23%)
CYCc 891..1084 CDD:214485 59/219 (27%)
Guanylate_cyc 918..1105 CDD:278633 59/202 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.